6H9N


Conserved Protein Domain Family
DivIC

?
pfam04977: DivIC 
Click on image for an interactive view with Cn3D
Septum formation initiator
DivIC from B. subtilis is necessary for both vegetative and sporulation septum formation. These proteins are mainly composed of an amino terminal coiled-coil.
Statistics
?
PSSM-Id: 368217
View PSSM: pfam04977
Aligned: 67 rows
Threshold Bit Score: 37.9759
Threshold Setting Gi: 81715527
Created: 6-May-2019
Updated: 18-Jul-2019
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6H9N_B  22 GKNGIHDYTRVNDDVAAQQATNAKLKARNDQLFAEIDDLNG---GQEALEERARNELSMTRPGETFYRLVPD 90  Escherichia coli 55989
Q9ZDA9  32 GNKGIIAYLKVNRQLEKAYDELKNLRAERVELEHNVKLLRTeslNKDMLEEQAKKILGIAAPNEQVFTIKDI 103 Rickettsia prowazekii str. Ma...
Q6N5V2  34 GRYGLTAQQELDQEITALTAELVQLRQQRAEAEQRVSLLRSdriDPDMLDERVRYQLDFANPADLVRMLPQR 105 Rhodopseudomonas palustris
Q89KW4  34 GKYGLNARQELDQEIIALTSELAQLKRERARSEQRVSLLRSariDPDMLDERARFQLDYVNPRDLVRMIPPN 105 Bradyrhizobium japonicum
Q92Q97  21 GGYGLEATKEFDRQIAERQARLDELTQTRKILEKEVELMSDgslERDMLDEKARLALNMSRSDEIVI-FHHP 91  Sinorhizobium meliloti
Q98MZ0  47 GEFGINSKYQLEAQTVALQAQLDAIKARRMELERRVRLMHDgtlEKDMLDEQARRALNLSQADEITIMLPAS 118 Mesorhizobium loti
Q2YPV2  34 GEYGLYARIQLEEQKSLLNAQLAKISADRIALEKRVALLRDgsiEKDMLDEQARRALNLSHPDEVTIITSre 105 Brucella abortus 2308
Q2G0R4  52 LVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNL-N---DKDYIEKIARDDYYLSNKGEVIFRLPEd 119 Staphylococcus aureus subsp. ...
Q9KGI5  56 LQTQAKMLEDIQQEKIALEQKLDELHAEQEFLEQEIKNY-N---DEEFIAEIARRDYYMTKPGETLFKLPKS 123 Bacillus halodurans
Q74C61  23 GERGLLRIYHLSNERDQIRQKVGVVRDENEKLKREIEALKS---DRRYLESIARKDFGLVRPNEIVYQFPTA 91  Geobacter sulfurreducens
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap