Conserved Protein Domain Family
DivIC

?
pfam04977: DivIC 
Septum formation initiator
DivIC from B. subtilis is necessary for both vegetative and sporulation septum formation. These proteins are mainly composed of an amino terminal coiled-coil.
Statistics
?
PSSM-Id: 309900
View PSSM: pfam04977
Aligned: 66 rows
Threshold Bit Score: 45.2755
Threshold Setting Gi: 81455229
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9A7J8        17 LIFYFAFHALTGDRGLLSISQRNADLAAKTRELRKIRAERMDLEARARLLRSgslSADLLEERARSLLGYADPRDYVIRV 96  Caulobacter vib...
Q8CZD2        41 IMLLFILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKL-K---DEDYAAKYTRAKYYYSKSREKVYTI 116 Streptococcus p...
Q74LA5        43 FAIAILIFGLQLIMVHVQTGRINSQIQTNKAELNQVNKTNKKLKSQVADL-K---DPDYVAKVIRYKFYYSKSGESIYTL 118 Lactobacillus j...
Q839B5        48 F-IIFAFSGIQLMKDYHRLGAFKQERADAIAESVAVDKKVKDLKKDVALL-K---DDDYVAKLARSRFLLSKEGEQIYPT 122 Enterococcus fa...
Q81PF6        40 iAAATLYVQFILTKQQEIIVEKKDTITNQKKQLVSLKKDEASLKTNIENLTD---DEEEILKFARKEYQFSKSNETIFVL 116 Bacillus anthracis
Q8EU25        44 IAIAFGSMTAYHVTQRSAKSDKLEEYEQLEEELVQLKNQEANLEEEINLL-Q---DEDYVLDIARTNYFFSKEGEKIFKL 119 Oceanobacillus ...
P37471        46 FLTAI-VLASSVWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKL-K---DEDYVTELARRDLFMSGDGEIIFNV 120 Bacillus subtil...
Q81J87        42 tfTIIASISVTFYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKL-N---DEEYVLKIARRDYFFSGKGEIIFPV 117 Bacillus cereus...
Q2G0R4        41 LLAIIVVLSILLVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNL-N---DKDYIEKIARDDYYLSNKGEVIFRL 116 Staphylococcus ...
WP_031669956  44 FAVVGGLLTITYTKQVLTLKEKKEKQVQVDKKMVAMKDEQDSLNEQIKKLHN---D-DYIAKLARSEYYLSKDGEIIFNI 119 Listeria monocy...
Q9A7J8        97 KRS 99  Caulobacter vibrioides
Q8CZD2       117 PDL 119 Streptococcus pneumoniae R6
Q74LA5       119 PEK 121 Lactobacillus johnsonii
Q839B5       123 PEQ 125 Enterococcus faecalis
Q81PF6       117 Pk- 118 Bacillus anthracis
Q8EU25       120 PDE 122 Oceanobacillus iheyensis
P37471       121 EKK 123 Bacillus subtilis subsp. subtilis str. 168
Q81J87       118 Sk- 119 Bacillus cereus ATCC 14579
Q2G0R4       117 PEd 119 Staphylococcus aureus subsp. aureus NCTC 8325
WP_031669956 120 PEE 122 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap