Conserved Protein Domain Family
DivIC

?
pfam04977: DivIC 
Septum formation initiator
DivIC from B. subtilis is necessary for both vegetative and sporulation septum formation. These proteins are mainly composed of an amino terminal coiled-coil.
Statistics
?
PSSM-Id: 309900
View PSSM: pfam04977
Aligned: 66 rows
Threshold Bit Score: 45.2755
Threshold Setting Gi: 81455229
Created: 25-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 81535362   17 LIFYFAFHALTGDRGLLSISQRNADLAAKTRELRKIRAERMDLEARARLLRSgslSADLLEERARSLLGYADPRDYVIRV 96
gi 81446744   41 IMLLFILPTFNLAQSYQQLLQRRQQLADLQTQYQTLSDEKDKETAFATKL-K---DEDYAAKYTRAKYYYSKSREKVYTI 116
gi 81668283   43 FAIAILIFGLQLIMVHVQTGRINSQIQTNKAELNQVNKTNKKLKSQVADL-K---DPDYVAKVIRYKFYYSKSGESIYTL 118
gi 81437504   48 F-IIFAFSGIQLMKDYHRLGAFKQERADAIAESVAVDKKVKDLKKDVALL-K---DDDYVAKLARSRFLLSKEGEQIYPT 122
gi 81581982   40 iAAATLYVQFILTKQQEIIVEKKDTITNQKKQLVSLKKDEASLKTNIENLTD---DEEEILKFARKEYQFSKSNETIFVL 116
gi 81747296   44 IAIAFGSMTAYHVTQRSAKSDKLEEYEQLEEELVQLKNQEANLEEEINLL-Q---DEDYVLDIARTNYFFSKEGEKIFKL 119
gi 585054     46 FLTAI-VLASSVWSQTSSLSAKEEKKEQLEKELKSLKTKQTDLKEEISKL-K---DEDYVTELARRDLFMSGDGEIIFNV 120
gi 81436126   42 tfTIIASISVTFYQQNSSIKAKEAKVKDMKKELDSLTNKEKSLKDEVQKL-N---DEEYVLKIARRDYFFSGKGEIIFPV 117
gi 122540146  41 LLAIIVVLSILLVVQKHRNDIDAQERKAKEAQFQKQQNEEIALKEKLNNL-N---DKDYIEKIARDDYYLSNKGEVIFRL 116
gi 685937943  44 FAVVGGLLTITYTKQVLTLKEKKEKQVQVDKKMVAMKDEQDSLNEQIKKLHN---D-DYIAKLARSEYYLSKDGEIIFNI 119

                 ...
gi 81535362   97 KRS 99
gi 81446744  117 PDL 119
gi 81668283  119 PEK 121
gi 81437504  123 PEQ 125
gi 81581982  117 Pk- 118
gi 81747296  120 PDE 122
gi 585054    121 EKK 123
gi 81436126  118 Sk- 119
gi 122540146 117 PEd 119
gi 685937943 120 PEE 122
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap