Conserved Protein Domain Family
MCR_C

?
pfam04609: MCR_C 
Methyl-coenzyme M reductase operon protein C
Methyl coenzyme M reductase (MCR) catalyzes the final step in methanogenesis. MCR is composed of three subunits, alpha (pfam02249), beta (pfam02241) and gamma (pfam02240). Genes encoding the beta (mcrB) and gamma (mcrG) subunits are separated by two open reading frames coding for two proteins C and D. The function of proteins C and D (this family) is unknown. This family nowalso includes family MtrC_related,
Statistics
?
PSSM-Id: 398344
Aligned: 32 rows
Threshold Bit Score: 373.856
Threshold Setting Gi: 74560650
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004077478     3 FVPITYKGGVYKHDIILDLIDDLGGHIVQKHMIAQDVVLQCLVPKEDIPLIKETGRPFGSEVFESPLVGTEIAVISPSLE 82  Methanoplanus...
WP_016359099     2 YETLTYSGGIHKSNEMRELIEDLGGFIIQENVIQMDLVLNMAVPVDDVDKIKEKSKELLGKLTFAPMAGSEIAIVSPTLA 81  Methanobrevib...
agres:mru_1931   2 YETLTFTGGIHKSEELKELIEDLGGFVLQSNILQMELVLNMAVPIDDVKIIEDKANELLGELSVAPMAGSEIAIVSPTLA 81  Methanobrevib...
CDG65789         2 YETLTYTGGVHKHEEIKELIEDLGGFVLQETTSQMDLVLTLAVPVEDVDKVDEKSRELLGEIKRAPMAGTEIAIVSPTLA 81  Methanobacter...
Q57559           6 YEIVRYEGGVYKNNIFKEWIEDIGGFVIQEHVMQLDVYMTLAIPQNELENIKEEAKKYKGKIIETPLAGTEIAVVAPSLS 85  Methanocaldoc...
jgi:Maeo_1204    2 YGIVRYEGGVYKNNIFKEWIEDIGGFIIQEHVMQLDVYMTLAIPQNEIENLKIESKKYKGKVVETPLAGTEIAIVAPSLS 81  Methanococcus...
WP_013181025     2 YQIVRYEGGVYKHNELKEWIEDVGGFIIQEHVMQLDVFMTVAFPEDEIGEFKALSKNYKGKVVETPLAGIEIAVVAPSLS 81  Methanococcus...
Q6M050           2 YQIIRYEGGVYKNNILKEWIEDVGGFIIQEHVMQLDVYMTIAIPQNEIENFKEEAKKYKGKIVETPLAGIEIAIVSPSLS 81  Methanococcus...
Q8TXS7           7 FETVIYEGGVYKADEMRDLVEDLGGFVLSEHQMQLEVHMVLAVPVDDLDVIERKAEELLGEIRRMPLAGTEIAVVGMSLA 86  Methanopyrus ...
WP_015504306     2 YEVIMYDGGIYRSDELFELIEDVGGVVLLKNRSAQMLTVTMSIPSEDREVVEALCKDIGGQVKEVPLAGTEIAVVGPTLG 81  Candidatus Me...
WP_004077478    83 IHHLPHTSCDVAEYLRSAGAKTNMIGLARGFGKRIANLNIEERDIINEHDCAVLMLGNFESCIRHKLPALRRGIK-VPII 161 Methanoplanus...
WP_016359099    82 RHHLPHAACDISEYLRRFGAKDNMIGLARGHGKGTSGISQEEKYLIEEHDLAIFALGSFKDCIIE-KSFLFDDID-IPVI 159 Methanobrevib...
agres:mru_1931  82 RHHLPHAACDISEYLRRYGAKDNMIGLARGHGKGTAGISETEKALIEEHDIAIFALGSFKQCIVD-KAYLYNDID-IPVI 159 Methanobrevib...
CDG65789        82 RQHLPHSACDISEYLRRYGAKDNMIGLSRGAGKGISRISEDEKRLIEEHDLVVFALGSFRECLMN-KTHLFNDID-IPVV 159 Methanobacter...
Q57559          86 RHHLPHTACDISEYLRRFGAKPNMIGLARGVGRDIAQLREKERRLIEEHDLAVYVMGNFEDCIKN-KTHLF-DVD-IPVV 162 Methanocaldoc...
jgi:Maeo_1204   82 RHHLPHTACDVSEYVRRFGAKPNMIGLSRGFGKKTSSIREAEKRLIEEHDIAIYVMGNFKSCLLD-KTHLF-DVD-IPVV 158 Methanococcus...
WP_013181025    82 RHHLPHIACDVSEYVRKFGAKPNMIGLSHGAGKSISQIKEKEKRLIEEHDLAIYVMGNFKSCIED-KTHLF-EVD-IPVI 158 Methanococcus...
Q6M050          82 RHHLPHIACDVSEYVRKFGAKPNMIGLAHGAGKNISEIREKEKRLIQEHDIAIYVMGNFESCILD-KTHLF-KVD-IPLV 158 Methanococcus...
Q8TXS7          87 RHHMPHPVCDIAEYLRRHGAKSNVIGLARGYGRELAQLRTREKRLLEEHDLVIFVVGNFKDCIEKYKLPLVRRIErVPVV 166 Methanopyrus ...
WP_015504306    82 RHHMPHPICDVAEYLRRLGAVTVVMGLARGRGKNTSQINLQETSIIDEYDACVFMLGNFKPCVETKADLLLSKIN-IPTV 160 Candidatus Me...
WP_004077478   162 LTGGPdTESLSVLadPPLEGYVGNIGRIGHRMKKQEgEIEYLDDLVDVISGVLDEKREEIAKDPLSISPAKLMSTLDEEM 241 Methanoplanus...
WP_016359099   160 VTGAP-DIDIEEL--PGADAYVGGLGRIPRRLKRGE-NIRALRRLVQTTEDILNRKKKYMAEDAPLAPPVMVKNAIERQL 235 Methanobrevib...
agres:mru_1931 160 VTGAP-EIDLEEL--PGVDAYVPGLGRIPRRLKRGE-NIRALKHLVQTIEDLLEKRKKELAQDPPIVPSILVKNEIENQV 235 Methanobrevib...
CDG65789       160 VTGAP-EMNLDDL--PGATAYVSGLGRIPRRLKRGE-NIRALRNLVEVVEDILDTRRKEMMDDPPIVPSILVKTEIENQV 235 Methanobacter...
Q57559         163 VTGGPeKIDIPY-------PYVGNLGRRSHRLRHGE-EIRALRKMVEVITELINERRRELSYDPPIVPPVVVKDEIEKQV 234 Methanocaldoc...
jgi:Maeo_1204  159 ITGAPeTLDIEQ-------PYIGNLGRRSQRLRHSE-ERQALKKMIEKTTELIDKRREELSFDAPIIPPVVLKDELEKSV 230 Methanococcus...
WP_013181025   159 ITGGPqSIEVDK-------TYIGNLGRRSQRLRRGS-EIRALDSMIEKITEKIGEKRLELSYDPPIIPPVVLKDEIEKNI 230 Methanococcus...
Q6M050         159 VTGGPeTLDIPY-------TYVGNLGRRAQRLRKGE-EIRALRQMIDEVTKKINDKRMELSYDPPIIPPVVLKDEIEKRI 230 Methanococcus...
Q8TXS7         167 VVGGPeEIDADDV------VYVGGIGRKPYRFRKGR-EITKLDEIVDVVSKIIEERRQELAEDPPVVPPMVVKDRINREL 239 Methanopyrus ...
WP_015504306   161 LMCGPkPEGIEDT----CDAIVWGIGRKAARMREPE-DRKKLEEVGDRVDDVLDEKKKALEEDPPFVHPSEIKALLE-NF 234 Candidatus Me...
WP_004077478   242 QITKGSTHPTPITVQTAGLRVKIPYGEYADEVSAV 276 Methanoplanus limicola
WP_016359099   236 PEIKDVHTPTPITTQLDGLRVKLDYDKYHDKIGQV 270 Methanobrevibacter
agres:mru_1931 236 PAIEGVFSPTPVTSQLSGLRVKLDYDNYHEEIENV 270 Methanobrevibacter ruminantium M1
CDG65789       236 KAVEEIYSPAPIVSQLDGVRVKLNYDEHKDEIAEV 270 Methanobacterium sp. MB1
Q57559         235 EEVYSILSPMPIVTQLDGLRVKLDYDKYADKIREV 269 Methanocaldococcus jannaschii DSM 2661
jgi:Maeo_1204  231 EEIFNVLSPMPITTQLDGLRIKLPYDACHEKIENV 265 Methanococcus aeolicus Nankai-3
WP_013181025   231 ADVHGIFAPMPIVTQLDGLRIKLDYDRSHEKIENL 265 Methanococcus voltae
Q6M050         231 DEVRGILAPMPIVTQLDGLRIKMDYDRNHEEIENV 265 Methanococcus maripaludis
Q8TXS7         240 KIEERFTSPMPITLQLDGLRVKAPYDEWADRVAEV 274 Methanopyrus kandleri
WP_015504306   235 EPIDMCLRPAPLVMHLDGLRAKISYDEYHEQIENM 269 Candidatus Methanomethylophilus alvus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap