Conserved Protein Domain Family
YihI

?
pfam04220: YihI 
Der GTPase activator (YihI)
YihI activates the GTPase activity of Der, a 50S ribosomal subunit stability factor. The stimulation is specific to Der as YihI does not stimulate the GTPase activity of Era or ObgE. The interaction of YihI with Der requires only the C-terminal 78 amino acids of YihI. A yihI deletion mutant is viable and shows a shorter lag period, but the same post-lag growth rate as a wild-type strain. yihI is expressed during the lag period. Overexpression of yihI inhibits cell growth and biogenesis of the 50S ribosomal subunit. YihI is an unusual, highly hydrophilic protein with an uneven distribution of charged residues, resulting in an N-terminal region with high pI and a C-terminal region with low pI.
Statistics
?
PSSM-Id: 398068
Aligned: 34 rows
Threshold Bit Score: 130.085
Threshold Setting Gi: 31340475
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6DB75         13 EKSKVKRKTREELEREARERKRDKKHRGHSAGSRTQEKASTDQNSGQRKVADPRIGSKKPVQLGVLDSAIVKPKPKSKPS 92  Pectobacterium...
Q65W23         29 YARPSKKLTRYELDAKAREDKKKKKHKGLTSGSRHSRS-EQHNNQQMQEKRDPRLGSRKKVPLVVEFVNNPEKGQFIQPV 107 [Mannheimia] s...
A6VLB1         29 KARPGKKLTRYELDARAREEKRKRKHKGLDSGSRHSAS-SDSGKNQQTEVKDPRIGSRKKVPLVVEFVNKPEKGQFIQPI 107 Actinobacillus...
P44844         27 KARSGKKLTCYELDAKAREDKKKRKHKGLASGSRHSAV-EEKANKLQNEIKDPKIGSKKKIPLVVEFVNKPEKGQVIPVI 105 Haemophilus in...
jgi:HSM_0769   40 LSRPGKKLTRYELDAKSREEKKKKKRKGLTAGSRHSAV-DTSKTIVLNEKKDPRVGSRKKVPLIVEFVNKPEKGMFIPSG 118 Histophilus so...
ACL32151       15 KPSKSRKPTRYELDLAAREEKKKRKHKGLPSGSRTNEG-NEQKQKVEKEVKDPRIGSRKKVPLMVEFVNQPEKGRVIKPV 93  Glaesserella p...
Q7VKZ7         28 SNSKKRKPTRYELDVQAREEKKKRKHKGLPTGSRNVI--TEQKTASAKVKKDPRVGSRKKVPLMVEFVNKPEKGQMIKPV 105 [Haemophilus] ...
jgi:Shew_3718  16 RPPRTKKEDRVVTG--------KKQKSGNKAGSRHNEKQIQQKQSGTAQAKDPRHGSKKPVALELPTKAPVAKQP----- 82  Shewanella loi...
Q15ZY6         14 GTPLAPKANRKPAPASP---KRNKKTLGKPSGTRNNPEQTSSQSKPSKVQKDPRVGSKKPIPLIVDDKPKAKIT------ 84  Pseudoalteromo...
jgi:Tola_0437  13 KRPDNKKKKPAFSAQEAREQKKQAKRKGLRPGARNSAE-TQEQKNQSVKNKDARVGSRKPVALVAEAPVAVVKAPKPAAP 91  Tolumonas auen...
Q6DB75         93 EpvekvvaAKP-TMSPEE-------ELAMLENDTRLDALLDRLDSGETLSAKDQSWVDETLDRIDILMEELGIElGDDDE 164 Pectobacterium...
Q65W23        108 Qvqp--aeEKVkKLDPML-------ELEQLENNECLNQLLDALDEGKTISAEDQKFVDECLDRIAQLMDELGIE-DEEES 177 [Mannheimia] s...
A6VLB1        108 Kt-----eKKPtALDPAT-------ELEQLENNECLNDLLDQLDAGKVLSKEDQVFVDECLARIAQLMDELGIS-DDEEG 174 Actinobacillus...
P44844        106 K--------QVkKQDPMK-------ELENLENNEILNELLDALDAGKTISKSDQQFVDECLDRISELMEELGIE-DEDES 169 Haemophilus in...
jgi:HSM_0769  119 Al-----eEKAkTIDPML-------ELTQLENNESLNQLLDELDAGKTLSKKDQIFVNQCLDRIAQLMAELGI---EEES 183 Histophilus so...
ACL32151       94 Pi-----eVEKpRLSPEQ-------ELEQLENNECLNQLLDDLEAGKTLSAQDQKFVDECLDRVHELMTELGIQ-DEEDE 160 Glaesserella p...
Q7VKZ7        106 Plep-snhATKaTVSPEV-------ELTQLENNECLNQLLDQLEAGKVLSTQDQQFVDECLDRVHELIIELGIE-DDEEN 176 [Haemophilus] ...
jgi:Shew_3718  83 ---------KApKMSDEQ-------KLLKLEEDPRLNKLLDMLEEGRDLNDADQAWLEKQLTEIERLMDRLGIT-EEDDL 145 Shewanella loi...
Q15ZY6         85 ---------KPkFFSPAQ-------ELESIEQNERFGMLLEKLDSDTALSREERAFVNKLTARHQELCDLLGIS-NDDDS 147 Pseudoalteromo...
jgi:Tola_0437  92 K--------AEpQMPPEQqlakwerELEKLENDDRLNALLDKLELEQPISEEDQEWLDKKLARHQELLKLLGLN-EEEKV 162 Tolumonas auen...
Q6DB75        165 EE--------QQEDMLQLL 175 Pectobacterium atrosepticum SCRI1043
Q65W23        178 ED--------D---LLRTF 185 [Mannheimia] succiniciproducens MBEL55E
A6VLB1        175 ED--------D---LLRTF 182 Actinobacillus succinogenes 130Z
P44844        170 ED--------D---LYRTF 177 Haemophilus influenzae Rd KW20
jgi:HSM_0769  184 ED--------D---LYRTF 191 Histophilus somni 2336
ACL32151      161 VE--------D---LLRQF 168 Glaesserella parasuis SH0165
Q7VKZ7        177 NE--------DL--LLRQF 185 [Haemophilus] ducreyi 35000HP
jgi:Shew_3718 146 EHvmkt-tvgSDDDLLDKF 163 Shewanella loihica PV-4
Q15ZY6        148 TAnagnsensTDDDLYDQF 166 Pseudoalteromonas atlantica T6c
jgi:Tola_0437 163 AS--------DPDELLQRF 173 Tolumonas auensis DSM 9187
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap