6OH4


Conserved Protein Domain Family
Nuc_sug_transp

?
pfam04142: Nuc_sug_transp 
Nucleotide-sugar transporter
This family of membrane proteins transport nucleotide sugars from the cytoplasm into Golgi vesicles. SSLC35A1 transports CMP-sialic acid, SLC35A2 transports UDP-galactose and SLC35A3 transports UDP-GlcNAc.
Statistics
?
PSSM-Id: 398009
Aligned: 10 rows
Threshold Bit Score: 421.743
Threshold Setting Gi: 74956492
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6OH4_A   8 VSLFFKLYCLTVMTLVAAAYTVALRYTRTTa--E-ELYFSTTAVCITEVIKLLISVGLLAKETGSLG--R-FKASLSENV 81 
P87041  11 KGIPMKYIALVLLTVQNSALILTLNYSRIMpgyDdKRYFTSTAVLLNELIKLVVCFSVGYHQFRKNVgkEaKLRAFLPQI 90  Schizosaccharomyces p...
O01879   6 NDSKFKYFGILLLTIQQASMPLMARYSRARe--DsNVFFTTVNVFMMEIIKVVVCSAIMIYTTKSVMk---YINELKLAI 80  Caenorhabditis elegans
P78382   8 VTLLFKLYCLAVMTLMAAVYTIALRYTRTS---DkELYFSTTAVCITEVIKLLLSVGILAKETGSLGr---FKASLRENV 81  human
Q02334  37 PSFVFKCYVIASMTFIWTAYTLTIKYTRSTv-nPdMMYSSTSVVLCAEILKLVITFAMFYKECNFDS--RqFSEQVSKYY 113 Caenorhabditis elegans
P78381  31 AHRRLKYISLAVLVVQNASLILSIRYARTL---PgDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNV--KhLVLFLHEAV 105 human
O77592   1 MSTNLKYLSLGILVFQTTSLVLTMRYSRTLk-eEgPRYLSSTAVVVAELLKIMACILLVYKDSKCSL--RaLNRILHDEI 77  dog
O16658   7 TSSNLKLISLVVLIVQTTALVLTLRYSQTQk-sEgPRYLSSTAVVCAEIIKLITCFFVIYRNNGYRF--SgMLNELNREI 83  Caenorhabditis elegans
O02345   5 KAETIKYSSLVVLVVQNCSLVLFMRYAMTK---DrPKFLKTITVLFGEIFKCTVSLLLACIEEKSIAk---GLRKIHHEF 78  Caenorhabditis elegans
O76865  18 NANTLKYISLLTLTLQNAILGLSMRYARTR---PgDIFLSSTAVLMAEFAKLITCLFLVFNEEGKDA--QkFVRSLHKTI 92  fruit fly
6OH4_A  82 LGs---pKELAKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWISVFMLCGGVTLV 158
P87041  91 FG-----GDSWKLAIPAFLYTCQNNLQYVAAGNLTAASFQVTYQLKILTTAIFSILLLHRRLGPMKWFSLFLLTGGIAIV 165 Schizosaccharomyces p...
O01879  81 FEh---rSETLKVCIPALIYTLQNNLYYIALSHLEATTFCISYQMKIFTTAIFMYFFLGKKLSTKQWWALVLLVLGVADI 157 Caenorhabditis elegans
P78382  82 LGs---pKELLKLSVPSLVYAVQNNMAFLALSNLDAAVYQVTYQLKIPCTALCTVLMLNRTLSKLQWVSVFMLCAGVTLV 158 human
Q02334 114 INa---pRELAKMSVPSFAYALQNNLDFVGLSNLDAGLYQVTTQLKVVSTAFFMMLFLGRKFSTRRWMAITLLMFGVAFV 190 Caenorhabditis elegans
P78381 106 LVq---yVDTLKLAVPSLIYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVAIV 182 human
O77592  78 LNk---pMETLKLAIPSGIYTLQNNLLYVALSNLDAATYQVTYQLKILTTALFSVSMLSKKLGVYQWLSLVILMTGVAFV 154 dog
O16658  84 FAspqtrADSLKVAVPAIMYVIQNNLLFFALKKLDAATYQVTYQLKILTTAIFSVTMLGKSLHRYNWMALILLTAGVALV 163 Caenorhabditis elegans
O02345  79 FVn---wRDTLKVLVPSAIYTVQNFLLYVAVDNLPAATYMVTYQLKILTTAAFTVLVLHRRLTIQQWISLFVLFAGVVVV 155 Caenorhabditis elegans
O76865  93 IAn---pMDTLKVCVPSLVYIVQNNLLYVSASHLDAATYQVTYQLKILTTAMFAVVILRRKLLNTQWGALLLLVMGIVLV 169 fruit fly
6OH4_A 159 QWKPAQAT------KVvv----------------------------------aqNPLLGFGAIAIAVLCSGFAGVYFEKV 198
P87041 166 QLQNLNSDdqmsagPM--------------------------------------NPVTGFSAVLVACLISGLAGVYFEKV 207 Schizosaccharomyces p...
O01879 158 QYVYSPPPased---------------------------------------veqNPMYGFMAVLTMCFTSAFAGVYLEKV 198 Caenorhabditis elegans
P78382 159 QWKPAQAtkvv----------------------------------------veqNPLLGFGAIAIAVLCSGFAGVYFEKV 198 human
Q02334 191 QMNNVSASeantkrETa------------------------------------eNYIVGLSAVLATCVTAGFAGVYFEKM 234 Caenorhabditis elegans
P78381 183 QAQQAGGGgprp---------------------------------------ldqNPGAGLAAVVASCLSSGFAGVYFEKI 223 human
O77592 155 QWPSDSQEldskelSAg-------------------------------------SQFVGLMAVLTACFSSGFAGVYFEKI 197 dog
O16658 164 QYPSGDSTtskstaAEhd----------------------------------asDNILGLGAVLAACFSSGFAGVYFEKI 209 Caenorhabditis elegans
O02345 156 QYDQKMSNerekaaAAavlsstlaptttvspfsnltttlttvvttaslasskteNSVLGFIAVLIACVLSGFAGIYFEKI 235 Caenorhabditis elegans
O76865 170 QLAQTEGPtsgsagGAaaaataas-----------------------sggapeqNRMLGLWAALGACFLSGFAGIYFEKI 226 fruit fly
6OH4_A 199 LKSSDT-SLWVRNIQMYLSGIVVTLAGTYLSDGAEIQEKG---------FFYGYTYYVWFVIFLASVGGLYTSVVVKYTD 268
P87041 208 LKDTNP-SLWVRNVQLSFFSLFPCLFTILMKDYHNIAENG---------FFFGYNSIVWLAILLQAGGGIIVALCVAFAD 277 Schizosaccharomyces p...
O01879 199 LKSSNA-SIWVQNIRLALIGLPISFLSMWYYDWEKINEQG---------AFRGWDFVVVCLTVTNSVGGILISVVIKYAD 268 Caenorhabditis elegans
P78382 199 LKSSDT-SLWVRNIQMYLSGIIVTLAGVYLSDGAEIKEKG---------FFYGYTYYVWFVIFLASVGGLYTSVVVKYTD 268 human
Q02334 235 LKDGGStPFWIRNMQMYSCGVISASI-ACLTDFSRISDKG---------FFFGYTDKVWAVVILLGVGGLYISLVMRYLD 304 Caenorhabditis elegans
P78381 224 LKGSSG-SVWLRNLQLGLFGTALGLVGLWWAEGTAVATRG---------FFFGYTPAVWGVVLNQAFGGLLVAVVVKYAD 293 human
O77592 198 LKETKQ-SVWIRNIQLGFFGSIFGLMGVYIYDGELVSKNG---------FFQGYNRLTWIVVILQALGGLVIAAVIKYAD 267 dog
O16658 210 LKTSKV-SLWIRNIQLAFFSVFGALLVCWLYDWQAISDDG---------FLRGYNGVIWIVVLLQAYGGLVIALVVKYAD 279 Caenorhabditis elegans
O02345 236 LKGSNV-SIWIRNIQLAFPSIFFAFLFASVKDNSSLYQDGpnpieiwnnMLQGFDWAVWVTVAINAFGGLVVAVVIKYAD 314 Caenorhabditis elegans
O76865 227 LKGAEI-SVWMRNVQLSLLSIPFGLLTCFVNDGSRIFDQG---------FFKGYDLFVWYLVLLQAGGGLIVAVVVKYAD 296 fruit fly
6OH4_A 269 NIMKGFSAAAAIVLSTIASVLLF-GLQITLSFALGALLVCVSIYLYG 314
P87041 278 NIMKNFSTSISIIISSLASVYLM-DFKISLTFLIGVMLVIAATFLYT 323 Schizosaccharomyces pombe 972h-
O01879 269 NILKAYAQSMAIIGAAVGSWILF-DFAPGFMFLLGTFMVIVSIIIYT 314 Caenorhabditis elegans
P78382 269 NIMKGFSAAAAIVLSTIASVMLF-GLQITLTFALGTLLVCVSIYLYG 314 human
Q02334 305 NLYKSMASAVSIILVVVLSMLIFpDIFIGMYFVLGTICVVLAVLLYN 351 Caenorhabditis elegans
P78381 294 NILKGFATSLSIVLSTVASIRLF-GFHVDPLFALGAGLVIGAVYLYS 339 human
O77592 268 NILKGFATSLSIILSTLISYFWLqDFVPTSVFFLGAILVITATFLYG 314 dog
O16658 280 NILKGFAVSLSIILSSFTSWLVLgDLTITTTFAIGATVVIFATFLYG 326 Caenorhabditis elegans
O02345 315 NILKAFATSLAIVLNCIAAYFLF-NFRPSILFLVGASGVIAAVFAYS 360 Caenorhabditis elegans
O76865 297 NILKGFATSLAIIISCVASIYIF-DFNLTLQFSFGAGLVIASIFLYG 342 fruit fly
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap