Conserved Protein Domain Family
RRM_2

?
pfam04059: RRM_2 
RNA recognition motif 2
Statistics
?
PSSM-Id: 112856
View PSSM: pfam04059
Aligned: 4 rows
Threshold Bit Score: 193.546
Threshold Setting Gi: 126947
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q8W4I9 743 RTTLMIKNIPNKYTSKMLLSAIDEHCKGTYDFLYLPIDFKNKCNVGYAFINLIEPEKIVPFFKAFNGKKWEKFNSEKVAT 822 thale cress
P08965 596 RTTVMIKNIPNKFTQQMLRDYIDVTNKGTYDFLYLRIDFVNKCNVGYAFINFIEPQSIITFGKARVGTQWNVFHSEKICD 675 Schizosaccharomyces p...
Q9SVV9 612 RTTLMIKNIPNKYTRNMLLAAIDEKNSGTYDFLYLPIDFKNKCNVGYAFINMVSPKFTIALYEAFNGKKWDKFNSEKVAS 691 thale cress
Q9SJG8 679 RTTLIIKNIPNKYTYKMLVAEIDEKHKGDYDFLCLPTDFKNKCNMGHAFINMVSPLHIVPFQQTFNGKIWEKFNSGKVAS 758 thale cress
Q8W4I9 823 LTYARIQGKTALIAHFQ 839 thale cress
P08965 676 ISYANIQGKDRLIEKFR 692 Schizosaccharomyces pombe 972h-
Q9SVV9 692 LAYARIQGKAALIAHFQ 708 thale cress
Q9SJG8 759 LAYAEIQGKSALASYMQ 775 thale cress
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap