Conserved Protein Domain Family
Sec20

?
pfam03908: Sec20 
Sec20
Sec20 is a membrane glycoprotein associated with secretory pathway.
Statistics
?
PSSM-Id: 112708
Aligned: 6 rows
Threshold Bit Score: 98.2627
Threshold Setting Gi: 93141310
Created: 20-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q12981                    133 QTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALF 212 human
Q9VNI9                    135 SQENDVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTDKMLLFFAFSLF 214 fr...
EFH61898                  143 SDAESITESLRRSRQLMVQEVERSTNTLVAFDESTGVLKKAESEYKGHRSLLSRTRNLLSTMQRQDVIDRIILIVGFSLF 222 Ar...
P28791                    204 SKTKQLTNNLVRGNQILQSGILQSDLNLDELRAQTNSLTQIDDKYTQFETVFKKTADLVKVLENASHQEKRDVYLSLGFL 283 Sa...
WGS:AACQ:CAALFM_C602570CA 148 SQNKQITKSLQASRQLLSAGILQSELNIDNIDQQTKDLYKLNEGFIQFNDLLNRSKKIVKFIEKQDKADRQRIYLSMGFF 227 Ca...
O42852                    122 TSASQVTAAMRDIHAQMVQAVDMSAENAMELSSSTNLLETLQEKYFGVEDVLYTSKRIIKSLKLSDRSDYFLVVSGFGFF 201 Sc...
Q9VNI9                    135 SQENDVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTDKMLLFFAFSLF 214 fr...
EFH61898                  143 SDAESITESLRRSRQLMVQEVERSTNTLVAFDESTGVLKKAESEYKGHRSLLSRTRNLLSTMQRQDVIDRIILIVGFSLF 222 Ar...
P28791                    204 SKTKQLTNNLVRGNQILQSGILQSDLNLDELRAQTNSLTQIDDKYTQFETVFKKTADLVKVLENASHQEKRDVYLSLGFL 283 Sa...
WGS:AACQ:CAALFM_C602570CA 148 SQNKQITKSLQASRQLLSAGILQSELNIDNIDQQTKDLYKLNEGFIQFNDLLNRSKKIVKFIEKQDKADRQRIYLSMGFF 227 Ca...
O42852                    122 TSASQVTAAMRDIHAQMVQAVDMSAENAMELSSSTNLLETLQEKYFGVEDVLYTSKRIIKSLKLSDRSDYFLVVSGFGFF 201 Sc...
Q12981                    213 LATVLYIVKKRL 224 human
Q9VNI9                    215 LACVFYIVQKRL 226 fruit fly
EFH61898                  223 VFAVVYVVSKRI 234 Arabidopsis lyrata subsp. lyrata
P28791                    284 LCCVSWVLWRRI 295 Saccharomyces cerevisiae S288C
WGS:AACQ:CAALFM_C602570CA 228 ILCCSWVVYRRI 239 Candida albicans SC5314
O42852                    202 IFVVVYLLFKRI 213 Schizosaccharomyces pombe 972h-
Q9VNI9                    215 LACVFYIVQKRL 226 fruit fly
EFH61898                  223 VFAVVYVVSKRI 234 Arabidopsis lyrata subsp. lyrata
P28791                    284 LCCVSWVLWRRI 295 Saccharomyces cerevisiae S288C
WGS:AACQ:CAALFM_C602570CA 228 ILCCSWVVYRRI 239 Candida albicans SC5314
O42852                    202 IFVVVYLLFKRI 213 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap