Conserved Protein Domain Family
Sec20

?
pfam03908: Sec20 
Sec20
Sec20 is a membrane glycoprotein associated with secretory pathway.
Statistics
?
PSSM-Id: 112708
View PSSM: pfam03908
Aligned: 6 rows
Threshold Bit Score: 98.2627
Threshold Setting Gi: 93141310
Created: 19-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q12981       133 QTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALF 212 human
Q9VNI9       135 SQENDVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTDKMLLFFAFSLF 214 fruit fly
P28791       204 SKTKQLTNNLVRGNQILQSGILQSDLNLDELRAQTNSLTQIDDKYTQFETVFKKTADLVKVLENASHQEKRDVYLSLGFL 283 Saccharomyces c...
Q5ACE5       148 SQNKQITKSLQASRQLLSAGILQSELNIDNIDQQTKDLYKLNEGFIQFNDLLNRSKKIVKFIEKQDKADRQRIYLSMGFF 227 Candida albicans
O42852       122 TSASQVTAAMRDIHAQMVQAVDMSAENAMELSSSTNLLETLQEKYFGVEDVLYTSKRIIKSLKLSDRSDYFLVVSGFGFF 201 Schizosaccharom...
XP_002885639 143 SDAESITESLRRSRQLMVQEVERSTNTLVAFDESTGVLKKAESEYKGHRSLLSRTRNLLSTMQRQDVIDRIILIVGFSLF 222 Arabidopsis lyr...
Q12981       213 LATVLYIVKKRL 224 human
Q9VNI9       215 LACVFYIVQKRL 226 fruit fly
P28791       284 LCCVSWVLWRRI 295 Saccharomyces cerevisiae S288c
Q5ACE5       228 ILCCSWVVYRRI 239 Candida albicans
O42852       202 IFVVVYLLFKRI 213 Schizosaccharomyces pombe 972h-
XP_002885639 223 VFAVVYVVSKRI 234 Arabidopsis lyrata subsp. lyrata
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap