5IWD


Conserved Protein Domain Family
Herpes_PAP

?
pfam03325: Herpes_PAP 
Herpesvirus polymerase accessory protein
The same proteins are also known as polymerase processivity factors.
Statistics
?
PSSM-Id: 397420
Aligned: 3 rows
Threshold Bit Score: 290.764
Threshold Setting Gi: 1722785
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5IWD_A 116 MCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWIGPHTRVKRNVKKAPCptgTVQILVHAGPPAIKFIl 195
P52439 156 VTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDAL---MAHIIVQVNPPTIKFV- 231 Human herpesvirus 6 (...
F5HC97 116 MCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWIGPHTRVKRNVKKAPCptgTVQILVHAGPPAIKFIl 195 Human herpesvirus 5 s...
5IWD_A 196 TNGSELEFTSNNRVSFHGVKNMRINVQLKNFYQTLLNCAVTKLPCTLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRG 275
P52439 232 TEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEE 311 Human herpesvirus 6 (...
F5HC97 196 TNGSELEFTANNRVSFHGVKNMRINVQLKNFYQTLLNCAVTKLPCTLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRG 275 Human herpesvirus 5 s...
5IWD_A 276 DPFDKN 281
P52439 312 SRFERM 317 Human herpesvirus 6 (strain Uganda-1102)
F5HC97 276 DPFDKN 281 Human herpesvirus 5 strain Merlin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap