Conserved Protein Domain Family
Herpes_PAP

?
pfam03325: Herpes_PAP 
Herpesvirus polymerase accessory protein
The same proteins are also known as polymerase processivity factors.
Statistics
?
PSSM-Id: 281337
View PSSM: pfam03325
Aligned: 2 rows
Threshold Bit Score: 674.484
Threshold Setting Gi: 395455166
Created: 15-Jul-2016
Updated: 4-Aug-2016
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
                         10        20        30        40        50        60        70        80
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395455166 116 MCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWIGPHTRVKRNVKKAPCPTGTVQILVHAGPPAIKFIL 195
gi 395455166 116 MCAPDFNMEFSSACVHGQDIVRESENSAVHVDLDFGVVADLLKWIGPHTRVKRNVKKAPCPTGTVQILVHAGPPAIKFIL 195
                         90       100       110       120       130       140       150       160
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395455166 196 TNGSELEFTANNRVSFHGVKNMRINVQLKNFYQTLLNCAVTKLPCTLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRG 275
gi 395455166 196 TNGSELEFTANNRVSFHGVKNMRINVQLKNFYQTLLNCAVTKLPCTLRIVTEHDTLLYVASRNGLFAVENFLTEEPFQRG 275
                        170       180       190       200       210       220       230       240
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*....|
gi 395455166 276 DPFDKNYVGNSGKSRGGGGGSGSLSSLANAGGLHDDGPGLDNDIMNEPMGLGGLGGGGGGGGKKHDRGGGGGSGTRKMSS 355
gi 395455166 276 DPFDKNYVGNSGKSRGGGGGSGSLSSLANAGGLHDDGPGLDNDIMNEPMGLGGLGGGGGGGGKKHDRGGGGGSGTRKMSS 355
                        250       260       270       280       290       300       310
                 ....*....|....*....|....*....|....*....|....*....|....*....|....*....|....*...
gi 395455166 356 GGGGGDHDHGLSSKEKYEQHKITSYLTSKGGSGGGGGGGGGGLDRNSGNYFNDAKEESDSEDSVTFEFVPNTKKQKCG 433
gi 395455166 356 GGGGGDHDHGLSSKEKYEQHKITSYLTSKGGSGGGGGGGGGGLDRNSGNYFNDAKEESDSEDSVTFEFVPNTKKQKCG 433
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap