1BP1


Conserved Protein Domain Family
LBP_BPI_CETP_C

?
pfam02886: LBP_BPI_CETP_C 
Click on image for an interactive view with Cn3D
LBP / BPI / CETP family, C-terminal domain
The N and C terminal domains of the LBP/BPI/CETP family are structurally similar.
Statistics
?
PSSM-Id: 397154
Aligned: 9 rows
Threshold Bit Score: 263.064
Threshold Setting Gi: 74962333
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1BP1_A 218 ETLDVQMK------G----EFYSENHHNPPPFAPPVMEFP--AAHDRMVYLGLSDYFFNTAGLVYQEAGVLKMTLRDDMI 285 human
P55058 228 SNLDMDFR------G----AFFPLTERNWSLPNRAVEPQL--QEEERMVYVAFSEFFFDSAMESYFRAGALQLLLVGDKV 295 human
Q18869 293 NTVELASWgeisfmGqgdtPFGPVDASWPGRSPFKTNVVDsvTNKDSMIELVVSDFLPNSLLYHAYVQRFIKVLLTPRTK 372 Caenorhabditis elegans
P17453 244 NNLDWLLK------G----EFFSLAHRSPPPFAPPALAFP--SDHDRMVYLGISEYFFNTAGFVYQKAGALNLTLRDDMI 311 cattle
Q63313 241 QTLDVMFK------G----EIFNRNHRSPVTTPTPTMSLP--EDSKQMVYFAISDQAFNIATRVYHQAGYLNFTITDDML 308 Norway rat
P18428 241 QMLEVMFK------G----EIFHRNHRSPVTLLAAVMSLP--EEHNKMVYFAISDYVFNTASLVYHEEGYLNFSITDDMI 308 human
P17454 242 GMLDVMFK------G----EIFPLDHRSPVDFLAPAMNLP--EAHSRMVYFSISDYVFNTASLAYHKSGYWNFSITDAMV 309 rabbit
Q17654 231 HHVDVRMRsdliwdD----EFVESG-MVENSTLASVEALP---RSTRMIDMFIDEHTVQSIIAAAHFAGHLKTKIESPFL 302 Caenorhabditis elegans
O17768 298 GAVNMMSKgeisyrGqggtPFFPPN----VRIPPP-HGVH-------MIEFYASDYLANSMLYHSYRQKFLDVTVGPESS 365 Caenorhabditis elegans
1BP1_A 286 PKESKFR---LTT-----KFFGtFLPEVAKKFPNMKIQIHVSASTPPHLSVQPT-GLTFYPAVDVQAFAVL--PNS-ALA 353 human
P55058 296 PHDLDML---LRA-----TYFG-SIVLLSPAVIDSPLKLELRVLAPPRCTIKPS-GTTISVTASVTIALVP--PDQ-PEV 362 human
Q18869 373 GVSSFLRttcEGS-----FCISdLAPQLAEQYPNSTVELAMSATRAPAVLFSEKnGGTISVSLGGLVVVFA--VNGnQRR 445 Caenorhabditis elegans
P17453 312 PKESKFR---LTT-----KFFGiLIPQVAKMFPDMQMQLFIWASLPPKLTMKPS-GLDLIFVLDTQAFAIL--PNS-SLD 379 cattle
Q63313 309 PPDSNIR---LNT-----KAFRpFTPLITRKYPDMNLELLGTVVSAPLLNVSPG-NLSLAPQMEIEGFVIL--PSS-ARE 376 Norway rat
P18428 309 PPDSNIR---LTT-----KSFRpFVPRLARLYPNMNLELQGSVPSAPLLNFSPG-NLSVDPYMEIDAFVLL--PSS-SKE 376 human
P17454 310 PADLNIR---RTT-----KSFRpFVPLLANLYPNMNLELQGTVNSEQLVNLSTE-NLLEEPEMDIEALVVL--PSS-ARE 377 rabbit
Q17654 303 KTSCDVL------------CIGtVLPELAEQVPNRTLSVEAATLSPPVIDLQQG-RALVYLNASLNVFAAP--PLKtVEG 367 Caenorhabditis elegans
O17768 366 PQLQGLL---LTScgpagFCLGeFLGTLGEQFPDRQVEIEFFAKKAPLIVFIDD-RSRFRLHGGLNMYVRPskPNQ-VKQ 440 Caenorhabditis elegans
1BP1_A 354 SLFLIGMHTTGSMEVSAESNRLVGELKLDRLLLELKHSNIGPFPVELLQDI-MnyIVPILVLPRVNEKLQKGFPLPTPAR 432 human
P55058 363 QLSSMTMDARLSAKMALRGKALRTQLDLRRFRIYSNHSALESLALIPLQAP-LktMLQIGVMPMLNERTWRGVQIPLPEG 441 human
Q18869 446 QVIVVDLDVVADARLSIQGHNVSGSVELRKFDLKRRTGTVDISDAEIDDIA-L--LVSQLSENLLNGLLVNGMPIPLPHV 522 Caenorhabditis elegans
P17453 380 PLFLLEMNLNLSVVVGAKSDRLIGELRLDKLLLELKHSDIGPFSVESLQSV-InyVMPTIVLPVINKKLQKGFPLPLPAY 458 cattle
Q63313 377 SVFRLGVVTNVFVSLTFDNSKVTGMLHPEKAQVRLIESKVGMFNVNLFQAF-LnyYLLNSLYPDVNDELAKGFPLPLPRR 455 Norway rat
P18428 377 PVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFNAELLEAL-LnyYILNTFYPKFNDKLAEGFPLPLLKR 455 human
P17454 378 PVFRLGVATNVSATLTLNTRKITGFLKPGRLQVELKESKVGGFNVELLEAL-LnyYILNNLYPKVNEKLAHRFPLPLLRH 456 rabbit
Q17654 368 SMLTINVETEFTLTMEMRNKRVKGYINMINAQANLVDSKVGLMSQKTVDFL-Vn-MSTPFLEDAVDVLIGRGLIVADP-- 443 Caenorhabditis elegans
O17768 441 QILKADTTMTANVNLWINGSIIVGNSTIENLDFKLLETKINDVDQDSFSDLgL--FGAEFLEKLLTEILQMGIALPTMQG 518 Caenorhabditis elegans
1BP1_A 433 VQL--YNVVLQPHQNFLLFGADVVY 455 human
P55058 442 INF--VHEVVTNHAGFLTIGADLHF 464 human
Q18869 523 LRI--KDSHINVLSRRMHIQVDVDV 545 Caenorhabditis elegans
P17453 459 IEL--FNLTLQPYQDFLLFGADVHY 481 cattle
Q63313 456 IKL--HDLDFQIHKNFLYLGANVQY 478 Norway rat
P18428 456 VQL--YDLGLQIHKDFLFLGANVQY 478 human
P17454 457 IQL--YDLLLQTHENFLLVGANIQY 479 rabbit
Q17654 444 FQFpsTNEHLSIHDKCLRWEADIVM 468 Caenorhabditis elegans
O17768 519 VIL--KSPKLTFHDRYLKVSTYFKL 541 Caenorhabditis elegans
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap