1NVP


Conserved Protein Domain Family
TFIIA_gamma_N

?
pfam02268: TFIIA_gamma_N 
Click on image for an interactive view with Cn3D
Transcription initiation factor IIA, gamma subunit, helical domain
Accurate transcription in vivo requires at least six general transcription initiation factors, in addition to RNA polymerase II. Transcription initiation factor IIA (TFIIA) is a multimeric protein which facilitates the binding of TFIID to the TATA box. The N-terminal domain of the gamma subunit is a 4 helix bundle.
Statistics
?
PSSM-Id: 460518
Aligned: 64 rows
Threshold Bit Score: 56.692
Created: 21-Mar-2022
Updated: 17-Oct-2022
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1NVP_D         2 YQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAAL 47 
EDW43770       3 YQHYRATTLGSTLQETLDEMMERGDITQEIVNLVLQKYDKSVTSAL 48 
Q9W5B9         3 YQHYRATTLGRTLQDTLDEMMERGDITKKIANLVLLRYDKSISTAL 48  fruit fly
EGD81618       4 nDHYRKTSLGLALQAALDELLEAQSISPDLMNHVLENFDTTMVKRL 49 
EDP06523       3 FQIYRNTSVGESLMETIEQMAQEEKLTEEIALAVLKQFDTSMSKAI 48 
PDM68280       6 YQLYRETTMGMALTEVLDQMIEDHLIPKTLAMKVLGTFDKNMNKAL 51 
EGT39837       4 YALYRGTTLGQALEQTLSDMDDEGLLPKSLVNKILFQFDKSMNKQI 49 
Q9BIB4         4 YALYRGTTLGQALDKTLEDMESEGLLTKSLASKVLQQFDKSMNKQI 49  Caenorhabditis elegans
KJE97049       2 tELFRETVLGKALIDILNEMVHAGALQSKLALEVLEHFDQVVEHTL 47 
XP_003095089   6 YQLYRNTTLGQALQKTLDDFVSEQIIPDSLSKKVMDSFDKSINRIL 51  Caenorhabditis remanei
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap