1WWQ


Conserved Protein Domain Family
ER

?
pfam01133: ER 
Click on image for an interactive view with Cn3D
Enhancer of rudimentary
Enhancer of rudimentary is a protein of unknown function that is highly conserved in plants and animals. This protein is found to be an enhancer of the rudimentary gene.
Statistics
?
PSSM-Id: 426071
Aligned: 40 rows
Threshold Bit Score: 136.92
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WWQ_A                9 SHTILLVQPTKRPEGRTYADYESVNECMEGVCKMYEEHLKRMNPNSPSITYDISQLFDFIDDLADLSCLVYRADTQTYQP 88  house mouse
Q20057                5 SHTVLLIQTSPRLDSRTWGDYESVTDALDALCKMFEDFLSKK--SAAPVTYDVSQVYEFLDKLSDVSMMIFNRETGQYIG 82  Caenorha...
XP_006680065         21 QHTILLLQAE--TTQRVWADFSTVEQAMEELISYFEHSLKEKAPNKLTLKYQIADFNRYIDTTPDIGCLVFDHETKSYVP 98  Batracho...
XP_002504625         51 RHTIILVQTTSNKKSRTFMDFEKVSMAMDGVCTMFEKRLKEMYPHMKDITYDIADLYNYVDALADLSAMVYEPKINAYLP 130 Micromon...
XP_006357080          4 RHTIVLMQTSQNRATRTFMDYESISQAMDGICALYERKLKELNPAIREITYDISDLYNFIDGLADMSALVYDHSIQAYLP 83  potato
XP_002989341          5 kKILLLVQQNQNQSSRTYLEFDSIPLCMEGVCAMYEKKLKDLNPELTSICYDIGDLYDFIDGLKDISALVYDPNVHGFLP 84  Selagine...
XP_001776002          4 RHTIILLQPTQNRATRTFIDYQSVPDAMDGICGLFEKRLKDANPNLRNITYDISDLYKYIDALTDMSALVFNPTILAYAP 83  Physcomi...
Q7RHB4                6 SDVVLLVQFSKKIESRTFVEYNSLKLALNGICQLYEQAIKENDPSVQRITYSMNDLFVYIDNIQKMTILLFHQPTWSYRL 85  Plasmodi...
ESS33368              2 SHTILLVQFSDRKDSRTYVDYESVPLALDGVCQLYEQALKATNPQLKNITYDVNDLFSYIDSLRDMCALVQDRQSNCYVP 81  Toxoplas...
WGS:AAPU:GI21527-PA   2 PHIIVLLQSTHHWASRTYLEYESIDDCMDALCRIFEGFMRLKNLYVDNKNY-LLELFNFLDTLEDISCVVMQGDSNMYTP 80  Drosophi...
1WWQ_A               89 YNKDWIKEKIYVLLRRQA 106 house mouse
Q20057               83 RTRAWIKQQVYEMMRGRC 100 Caenorhabditis elegans
XP_006680065         99 HDKTWIKKQVFTMLRGIV 116 Batrachochytrium dendrobatidis JAM81
XP_002504625        131 YNKEWVKKKAFAHLKRQA 148 Micromonas commoda
XP_006357080         84 YDRQWIKQKTLQHLKKLA 101 potato
XP_002989341         85 YDRQWIKHRSFQHLRKLA 102 Selaginella moellendorffii
XP_001776002         84 FDRSWIKQQAFERLKALA 101 Physcomitrella patens
Q7RHB4               86 HDKKWIKQKLVEHIKDQI 103 Plasmodium yoelii yoelii
ESS33368             82 HDKQWIKDQAFKHLKKQA 99  Toxoplasma gondii VEG
WGS:AAPU:GI21527-PA  81 HNKLWIKEQLFLRLDrld 98  Drosophila mojavensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap