2XSH


Conserved Protein Domain Family
Ring_hydroxyl_B

?
pfam00866: Ring_hydroxyl_B 
Click on image for an interactive view with Cn3D
Ring hydroxylating beta subunit
This subunit has a similar structure to NTF-2 and scytalone dehydratase.
Statistics
?
PSSM-Id: 425916
Aligned: 21 rows
Threshold Bit Score: 119.321
Created: 16-Apr-2021
Updated: 29-Sep-2021
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2XSH_D         34 EAQLLDHRAYEAWFA-LLDKDIHYFMPLRTNRMIREGELEYsgdQDLAHFDETHETMYGRIRKVTSDVGWAENPPSRTRH 112 Paraburkholder...
jgi:Saro_3834  19 DANALDSKDMPGWLEnYAEEDQASYYCRAAENTEHNLEL-------GFMFDDCRARLEDRVTYVNEIWAG-TFQDYRTRH 90  Novosphingobiu...
Q9I230         23 EAELLDDRLLDTWFA-LFERAARYRVLPLQEQLAGQAPE-----DSLYIIDDDHVRLRERVDSILGGHTWMEQPRSRTRR 96  Pseudomonas ae...
WP_011077868   34 EARLLDERRFWEWDR-LFTDSGMYWAPQQHG----QANP-F---EHISLFWENRMLREVRIRRVENPRNWSQQPPTRTAH 104 Pseudomonas
O85674         16 KAELCDNYDWDAYID-LYDEDSEYHIPQWIDDHNYVQDPNQ---GLSYIYYEDRSGLEDRVFRIRTGKAASATPLPRTQH 91  Acinetobacter ...
Q9I0W9         16 HAELCDAQDWDGYLA-QFDEQCEFHLPQWESEQRYTRDPKR---ETSLIYYPSRAGLEDRVFRIRTGKAASTVPMPRTLH 91  Pseudomonas ae...
BAN51390       16 NAEACDAQDWDTYLS-MFSDDSEFHLPQWDSEHEYTRDPKR---AMSLIYYPNRGGLEDRVFRIRTGKSASTVPMPRTLH 91  Pseudomonas re...
jgi:Saro_3863  19 EAMALDDKDWDAWLA-LYHEEAEYWVPAWDDHERPTADPQN---EVSLIYYPNRGGLEDRVFRIRTRRSAASTPQPRTVH 94  Novosphingobiu...
Q9I0W5         15 EARYLDDKDWDAWLA-LYAADASFWMPSWDDRDQLTEDPQR---EISLIWYGNRGGLEDRVFRIRTERSSATLPDTRTSH 90  Pseudomonas ae...
WP_011806224   41 EAHLLDIQAYKAWLEhCVAPEIKYQVISRELRSTSERRYQLn--DAVNLYNENYQQLKVRVEHQMDPQNWANNPKIRFTR 118 Acidovorax sp....
2XSH_D        113 LVSNVIVKET-ATPDTFEVNSAFILYRNRLE--RQVDIFAGERRDVLRRADNNlgFSIAKRTILLDASTLLS 181 Paraburkholderia xenov...
jgi:Saro_3834  91 FVQR--VSHRqVDARTVEVVSNFSVFMTPMDvgVTQVLAAGRYLDTMRLSDDGg-AKLLSRRAELDTSVLPR 159 Novosphingobium aromat...
Q9I230         97 LVGNVRLKR--VEGELVSSRSNFVVHQFRNR---EAWSFVGEASHVLRDGPGG--LRIVSREIRLDHETISA 161 Pseudomonas aeruginosa
WP_011077868  105 LVGNVMVEGL-DRQGLLVVSATFQVSEWRLV----QRQLAGRYTYKLASQEGGg-WKIQLKRVDLINCndvf 170 Pseudomonas
O85674         92 NIHN--VQVKtLEDGLIEAKVSWRTLYNRQG---LEGCFYGRATYVLRPTEDS--FRIRRQHSVLLNDKIDS 156 Acinetobacter baylyi ADP1
Q9I0W9         92 QIGN--VRIAeEGDGLLRVRVNWQTLFQRLD---QTGSFFGHATYRLKPHGEA--WLIARKHIVLLNDRIDS 156 Pseudomonas aeruginosa
BAN51390       92 LLSNVRIAPL--ADDELEVQVNWHTLYYRLQ---TAEQFFGRATYRLRPDGES--WKIARKHVLLLNDTINS 156 Pseudomonas resinovora...
jgi:Saro_3863  95 QFSL--LSAE-ESDGQVHARTSWTTVSVLEG---KVATLSGWAFYDLEPRDDS--FVIRRKKTIVVTDLFQe 158 Novosphingobium aromat...
Q9I0W5         91 NLSN--IELLgEDDGICRVRCNWHTLSYRYK---TVDSYFGTTFYDLDVRGES--PLIKAKKVILKNDYVRQ 155 Pseudomonas aeruginosa
WP_011806224  119 FVTNVTAAKDkSAPEMLHVRSNLILHRARRE--NQVDVFYATREDKWKRIEGGg-IKLVERFVDYPERIPQt 187 Acidovorax sp. JS42
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap