Conserved Protein Domain Family
HemolysinCabind

?
pfam00353: HemolysinCabind 
Haemolysin-type calcium-binding repeat (2 copies)
Statistics
?
PSSM-Id: 425631
Aligned: 254 rows
Threshold Bit Score: 23.9368
Created: 26-Apr-2021
Updated: 29-Sep-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q1GKK1            185 HGGSGADVVAGGAGSDAVHGNDDDDRVFGGAGEDTL 220  Ruegeria sp. TM1040
Q5LQT5            520 IGDGGNDTLEGGTDDDSITGGAGSDVIFTGGAASNG 555  Ruegeria pomeroyi
WP_015145347      254 PGRGEIDTLAGGAGADTFRLGDSNNVYYNDGQNNTL 289  Pleurocapsa minor
Q16CV4            942 SGTGNADNIHGKRGSDFITGGDGNDFIFGGAQNDRL 977  Roseobacter denitrificans OCh 114
jgi:PCC7424_1242  855 PAVGGTETLIGGAGADNITGGNGNDSIYGGFSTGAQ 890  Gloeothece citriformis PCC 7424
WP_012165817     1209 MSLGGLNRIYGAGKNNTIQGGQDKDTIHAGGESNTY 1244 Acaryochloris marina
WP_015405435      578 ITVTHINRIEGGGGADTITGSSGDDILYGGTLTNQE 613  Desulfocapsa sulfexigens
6_pfamImport        1 IGGPGNDSLYGGAGNDVIIGGPGNSIISGDKGLDTL 36  
jgi:Chro_5373     113 YGGYGNDDLEGSFGNDVVNGGAGDDIINGAGGFGLE 148  Chroococcidiopsis thermalis PCC 7203
Q31NQ2            429 IAINGSNLIEGNNDNDSIVGGTDSDTINGGTGADTL 464  Synechococcus elongatus PCC 7942
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap