NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS54245.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
54245.1 Public Homo sapiens 19 PEPD 24 110 108 CCDS HistoryNCBI Gene:5184Re-query CCDS DB by CCDS ID:54245.1Re-query CCDS DB by GeneID:5184See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 54245.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000397032.8 ENSP00000380226.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000397032.8Link to Ensembl Protein Viewer:ENSP00000380226.3Re-query CCDS DB by Nucleotide ID:ENST00000397032Re-query CCDS DB by Protein ID:ENSP00000380226
Original member Current member NCBI NM_001166056.2 NP_001159528.1 Accepted alive Link to Nucleotide Sequence:NM_001166056.2Link to Protein Sequence:NP_001159528.1Re-query CCDS DB by Nucleotide ID:NM_001166056Re-query CCDS DB by Protein ID:NP_001159528Link to BLAST:NP_001159528.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001159528.1 452 P12955-2 452 100% 0 0

Chromosomal Locations for CCDS 54245.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 19 (NC_000019.10)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 33387344 33387481 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33387890 33388081 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33391295 33391479 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33401721 33401869 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33411672 33411749 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33413575 33413643 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33478046 33478090 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33489996 33490057 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33493290 33493337 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33500938 33501001 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33511028 33511155 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33512593 33512776 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 33521744 33521760 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1359 nt):
ATGGCGGCGGCCACCGGACCCTCGTTTTGGCTGGGGAATGAAACCCTGAAGGTGCCGCTGGCGCTCTTTG
CC
TTGAACCGGCAGCGCCTGTGTGAGCGGCTGCGGAAGAACCCTGCTGTGCAGGCCGGCTCCATCGTGGT
C
CTGCAGGGCGGGGAGGAGACTCAGCGCTACTGCACCGACACCGGGGTCCTCTTCCGCCAGGAGTCCTTC
TTT
CACTGGGCGTTCGGTGTCACTGAGCCAGGCTGCTATGGTGTCATCGATGTTGACACTGGGAAGTCGA
CC
CTGTTTGTGCCCAGGCTTCCTGCCAGCCATGCCACCTGGATGGGAAAGATCCATTCCAAGGAGCACTT
C
AAGGAGAAGTATGCCGTGGACGACGTCCAGTACGTAGATGAGATTGCCAGCGTCCTGACGTCACAGAAG
CCC
TCTGTCCTCCTCACTTTGCGTGGCGTCAACACGGACAGCGGCAGTGTCTGCAGGGAGGCCTCCTTTG
AC
GGCATCAGCAAGTTCGAAGTCAACAATACCATTCTTCACCCAGAGATCGTTGAGTGCCTCTTCGAGCA
C
TACTGCTACTCCCGGGGCGGCATGCGCCACAGCTCCTACACCTGCATCTGCGGCAGTGGTGAGAACTCA
GCC
GTGCTACACTACGGACACGCCGGAGCTCCCAACGACCGAACGATCCAGAATGGGGATATGTGCCTGT
TC
GACATGGGCGGTGAGTATTACTGCTTCGCTTCCGACATCACCTGCTCCTTTCCCGCCAACGGCAAGTT
C
ACTGCAGACCAGAAGGCCGTCTATGAGGCAGTGCTGCGGAGCTCCCGTGCCGTCATGGGTGCCATGAAG
CCA
GGTGTCTGGTGGCCTGACATGCACCGCCTGGCTGACCGCATCCACCTGGAGGAGCTGGCCCACATGG
GC
ATCCTGAGCGGCAGCGTGGACGCCATGGTCCAGGCTCACCTGGGGGCCGTGTTTATGCCTCACGGGCT
T
GGCCACTTCCTGGGCATTGACGTGCACGACGTGGGAGGCTACCCAGAGGGCGTGGAGCGCATCGACGAG
CCC
GGCCTGCGGAGCCTGCGCACTGCACGGCACCTGCAGCCAGGCATGGTGCTCACCGTGGAGCCGGGCA
TC
TACTTCATCGACCACCTCCTGGATGAGGCCCTGGCGGACCCGGCCCGCGCCTCCTTCCTTAACCGCGA
G
GTCCTGCAGCGCTTTCGCGGTTTTGGCGGGGTCCGCATCGAGGAGGACGTCGTGGTGACTGACAGCGGC
ATA
GAGCTGCTGACCTGCGTGCCCCGCACTGTGGAAGAGATTGAAGCATGCATGGCAGGCTGTGACAAGG
CC
TTTACCCCCTTCTCTGGCCCCAAGTAG


Translation (452 aa):
MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESF
F
HWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMG
KIHSKEHFKEKYAVDDVQYVDEIASVLTSQK
P
SVLLTL
RGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECLFEHYCYSRGGMRHSSYTCICGSGENS
A
VLHYGHAGAPNDRTIQNGDM
CLFDMGGEYYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMK
P
GVWWPDMHRLADRIHLEELAHMGILSGSVDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDE
P
GLRSLRTARHLQPGMVLTVEPGIYFIDHLLDEALADPARASFLNREVLQRFRGFGG
VRIEEDVVVTDSG
I
ELLTCVPRTVEEIEACMAGCDKAFTPFSGPK




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser