NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Thursday, April 25, 2024, starting at 7:00 a.m. EDT for up to 120 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS42981.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
42981.1 Public Homo sapiens 22 TXNRD2 24 110 108 CCDS HistoryNCBI Gene:10587Re-query CCDS DB by CCDS ID:42981.1Re-query CCDS DB by GeneID:10587See the combined annotation on chromosome 22 in Sequence Viewer

Public Note for CCDS 42981.1
This CCDS ID represents the protein described in PMIDs: 9923614 and 10215850. This transcript is supported by AF106697.1. It should be noted this transcript is predicted to undergo nonsense-mediated mRNA decay (NMD). However, the protein is represented because it was detected endogenously in PMID: 9923614. It is likely that the majority of transcripts representing this variant will undergo NMD, while some low level of NMD escape may allow for the expression of this protein.

Public since: CCDS release 5, NCBI annotation release 36.3, Ensembl annotation release 47

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
Contains selenocysteine
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 42981.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000400521.7 ENSP00000383365.1 MANE Select Accepted alive Link to Ensembl Transcript Viewer:ENST00000400521.7Link to Ensembl Protein Viewer:ENSP00000383365.1Re-query CCDS DB by Nucleotide ID:ENST00000400521Re-query CCDS DB by Protein ID:ENSP00000383365
Original member Current member NCBI NM_006440.5 NP_006431.2 MANE Select Accepted alive Link to Nucleotide Sequence:NM_006440.5Link to Protein Sequence:NP_006431.2Re-query CCDS DB by Nucleotide ID:NM_006440Re-query CCDS DB by Protein ID:NP_006431Link to BLAST:NP_006431.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_006431.2 524 Q9NNW7-1 524 100% 0 0

Chromosomal Locations for CCDS 42981.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '-' strand of Chromosome 22 (NC_000022.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22See the combined annotation on chromosome 22 in Sequence Viewer

Chromosome Start Stop Links
22 19877105 19877234 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19878090 19878187 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19878366 19878437 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19880179 19880271 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19880622 19880717 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19883325 19883461 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19895407 19895581 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19898039 19898130 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19899049 19899068 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19911377 19911447 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19915214 19915276 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19915765 19915843 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19918143 19918217 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19918860 19919004 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19919543 19919599 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19931030 19931098 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22
22 19941701 19941803 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 22Link to Ensembl Genome Browser on chromosome 22

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair. This works on the replacement symbol in the Translation Exceptions section also.

Translation Exceptions:
replace the symbol * (codon TGA) with U at amino acid position 523

Nucleotide Sequence (1575 nt):
ATGGCGGCAATGGCGGTGGCGCTGCGGGGATTAGGAGGGCGCTTCCGGTGGCGGACGCAGGCCGTGGCGG
GC
GGGGTGCGGGGCGCGGCGCGGGGCGCAGCAGCAGGTCAGCGGGACTATGATCTCCTGGTGGTCGGCGG
G
GGATCTGGTGGCCTGGCTTGTGCCAAGGAGGCCGCCCAGCTGGGAAGGAAGGTGGCCGTGGTGGACTAC
GTG
GAACCTTCTCCCCAAGGCACCCGGTGGGGCCTCGGCGGCACCTGCGTCAACGTGGGCTGCATCCCCA
AG
AAGCTGATGCACCAGGCGGCACTGCTGGGAGGCCTGATCCAAGATGCCCCCAACTATGGCTGGGAGGT
G
GCCCAGCCCGTGCCGCATGACTGGAGGAAGATGGCAGAAGCTGTTCAAAATCACGTGAAATCCTTGAAC
TGG
GGCCACCGTGTCCAGCTTCAGGACAGAAAAGTCAAGTACTTTAACATCAAAGCCAGCTTTGTTGACG
AG
CACACGGTTTGCGGCGTTGCCAAAGGTGGGAAAGAGATTCTGCTGTCAGCCGATCACATCATCATTGC
T
ACTGGAGGGCGGCCGAGATACCCCACGCACATCGAAGGTGCCTTGGAATATGGAATCACAAGTGATGAC
ATC
TTCTGGCTGAAGGAATCCCCTGGAAAAACGTTGGTGGTCGGGGCCAGCTATGTGGCCCTGGAGTGTG
CT
GGCTTCCTCACCGGGATTGGGCTGGACACCACCATCATGATGCGCAGCATCCCCCTCCGCGGCTTCGA
C
CAGCAAATGTCCTCCATGGTCATAGAGCACATGGCATCTCATGGCACCCGGTTCCTGAGGGGCTGTGCC
CCC
TCGCGGGTCAGGAGGCTCCCTGATGGCCAGCTGCAGGTCACCTGGGAGGACAGCACCACCGGCAAGG
AG
GACACGGGCACCTTTGACACCGTCCTGTGGGCCATAGGTCGAGTCCCAGACACCAGAAGTCTGAATTT
G
GAGAAGGCTGGGGTAGATACTAGCCCCGACACTCAGAAGATCCTGGTGGACTCCCGGGAAGCCACCTCT
GTG
CCCCACATCTACGCCATTGGTGACGTGGTGGAGGGGCGGCCTGAGCTGACACCCATAGCGATCATGG
CC
GGGAGGCTCCTGGTGCAGCGGCTCTTCGGCGGGTCCTCAGATCTGATGGACTACGACAATGTTCCCAC
G
ACCGTCTTCACCCCGCTGGAGTATGGCTGTGTGGGGCTGTCCGAGGAGGAGGCAGTGGCTCGCCACGGG
CAG
GAGCATGTTGAGGTCTATCACGCCCATTATAAACCACTGGAGTTCACGGTGGCTGGACGAGATGCAT
CC
CAGTGTTATGTAAAGATGGTGTGCCTGAGGGAGCCCCCACAGCTGGTGCTGGGCCTGCATTTCCTTGG
C
CCCAACGCAGGCGAAGTTACTCAAGGATTTGCTCTGGGGATCAAGTGTGGGGCTTCCTATGCGCAGGTG
ATG
CGGACCGTGGGTATCCATCCCACATGCTCTGAGGAGGTAGTCAAGCTGCGCATCTCCAAGCGCTCAG
GC
CTGGACCCCACGGTGACAGGCTGCTGAGGGTAA


Translation (524 aa):
MAAMAVALRGLGGRFRWRTQAVAGGVRGAARGAAAGQRDYDLLVVGGGSGGLACAKEAAQLGRKVAVVDY
V
EPSPQ
GTRWGLGGTCVNVGCIPKKLMHQAALLGGLIQDAPNYGWEVAQPVPHDWRKMAEAVQNHVKSLN
W
GHRVQLQD
RKVKYFNIKASFVDEHTVCGVAKGGKEILLSADHIIIATGGRPRYPTHIEGALEYGITSDD
I
FWLKESPGK
TLVVGASYVALECAGFLTGIGLDTTIMMRSIPLRGFDQQMSSMVIEHMASHGTRFLRGCA
P
SRVRRLPDGQLQVTWEDSTTGKEDTGTFDTVLWAI
GRVPDTRSLNLEKAGVDTSPDTQKILVDSREATS
V
PHIYAIGDVVE
GRPELTPIAIMAGRLLVQRLFGGSSDLMDYDNVPTTVFTPLEYGCVGLSEEEAVARHG
Q
EHVE
VYHAHYKPLEFTVAGRDASQCYVKMVCLREPPQLVLGLHFLGPNAGEVTQGFALGIKCGASYAQV
M
RTVGIHPTCSEEVVKLRISKRSGLDPTVTGCUG




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser