NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
The CCDS database will be unavailable on Wednesday, July 16, 2025, starting at 8:00 a.m. EDT for up to 60 minutes.
  

CCDS
Home
FTP
Process
Releases & Statistics

Collaborators
EBI
HGNC
MGI
NCBI

Contact Us
email CCDS

Genome Displays

Ensembl
NCBI
UCSC
VEGA

Related Resources
Gene
HomoloGene
MANE
RefSeq


Report for CCDS30719.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30719.1 Public Homo sapiens 1 SCP2 24 110 108 CCDS HistoryNCBI Gene:6342Re-query CCDS DB by CCDS ID:30719.1Re-query CCDS DB by GeneID:6342See the combined annotation on chromosome 1 in Sequence Viewer

Public Note for CCDS 30719.1
This CCDS ID represents a variant of the SCP2 locus that uses a downstream promoter, known as the SCP2 promoter. This promoter initiates transcription in an internal exon compared to the longer CCDS572.1 variant, which uses the upstream SCPx promoter. Data in PMIDs 7654720, 7698762 and 14563822, as well as chromatin regulatory features (including Ensembl ENSR00000282553 and ENSR00000282554), support the presence of an active downstream SCP2 promoter.

Public since: CCDS release 3, NCBI annotation release 36.2, Ensembl annotation release 41

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 30719.1

Original Current Source Nucleotide ID Protein ID MANE Status in CCDS Seq. Status Links
Original member Current member EBI ENST00000408941.7 ENSP00000386214.3 Accepted alive Link to Ensembl Transcript Viewer:ENST00000408941.7Link to Ensembl Protein Viewer:ENSP00000386214.3Re-query CCDS DB by Nucleotide ID:ENST00000408941Re-query CCDS DB by Protein ID:ENSP00000386214
Original member Current member EBI ENST00000488965.1 ENSP00000435783.1 Accepted alive Link to Ensembl Transcript Viewer:ENST00000488965.1Link to Ensembl Protein Viewer:ENSP00000435783.1Re-query CCDS DB by Nucleotide ID:ENST00000488965Re-query CCDS DB by Protein ID:ENSP00000435783
Original member Current member NCBI NM_001007250.3 NP_001007251.1 Accepted alive Link to Nucleotide Sequence:NM_001007250.3Link to Protein Sequence:NP_001007251.1Re-query CCDS DB by Nucleotide ID:NM_001007250Re-query CCDS DB by Protein ID:NP_001007251Link to BLAST:NP_001007251.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001007251.1 59 P22307-5 59 100% 0 0

Chromosomal Locations for CCDS 30719.1

Assembly GRCh38.p14 (GCF_000001405.40)

On '+' strand of Chromosome 1 (NC_000001.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 53015021 53015043 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53027969 53028071 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1
1 53047858 53047911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (180 nt):
ATGGGTTTTCCGGAAGCCGCCAGTTCTTTTAGAACTCATCAAATTGAAGCTGTTCCAACCAGCTCTGCAA
GT
GATGGATTTAAGGCAAATCTTGTTTTTAAGGAGATTGAGAAGAAACTTGAAGAGATAAGAAGGCTGAC
T
GCACAATCACAATGGCTGACTCAGACTTCCTGGCTTTAA


Translation (59 aa):
MGFPEAASSFRTHQIEAVPTSSASDGFKANLVFKEIEKKLEEIRRLTAQSQWLTQTSWL



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser