Format
Sort by
Items per page

Send to

Choose Destination

Links from PubMed

Items: 1 to 20 of 761

1.

111In/68Ga-Labeled anti-epidermal growth factor receptor, native chemical ligation cyclized Affibody ZHER2:342min.

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2013 Apr 3 [updated 2013 May 23].

2.

111In-Labeled anti-epidermal growth factor receptor Affibody PEP09239.

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2013 Mar 28 [updated 2013 May 2].

3.

11C/68Ga-Labeled sel-tagged anti-epidermal growth factor receptor 2 affibody ZHER2:342.

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2012 Oct 2 [updated 2012 Oct 25].

4.

111In/125I/99mTc-Labeled N-terminus tri-(histidine-glutamate) (HE)3-tagged and N- or C-terminus hexahistidine (H6)-tagged anti-epidermal growth factor receptor Affibody ZHER2:342-C.

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2012 Jul 16 [updated 2012 Aug 9].

5.

18F-Labeled Cys-ZHER2:342, an anti-epidermal growth factor receptor-2 Affibody.

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2012 Jul 3 [updated 2012 Aug 9].

6.

111In-Labeled DOTA-conjugated 6-aminohexanoic linker-containing variant of anti-epidermal growth factor receptor 2 Affibody ZHER2:342 (ABY-003).

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Jul 8 [updated 2011 Aug 23].

7.

18F-Labeled N-(4-fluorobenzylidene)oxime-dimeric (ZHER2:477)2.

Shan L.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Nov 2 [updated 2012 Jan 4].

8.

18F-Labeled N-(4-fluorobenzylidene)oxime-monomeric ZHER2:477.

Shan L.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Nov 2 [updated 2012 Jan 4].

9.

Evaluation of backbone-cyclized HER2-binding 2-helix affibody molecule for in vivo molecular imaging.

Honarvar H, Jokilaakso N, Andersson K, Malmberg J, Rosik D, Orlova A, Karlström AE, Tolmachev V, Järver P.

Nucl Med Biol. 2013 Apr;40(3):378-86. doi: 10.1016/j.nucmedbio.2012.12.009. Epub 2013 Jan 26.

PMID:
23357083
10.

64Cu-1,4,7,10-Tetraazacyclododecane-1,4,7-β max tris(acetic acid)-10-acetate mono(N-ethylmaleimide amide)-dimeric (ZHER2:477)2.

Shan L.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Nov 2 [updated 2011 Nov 30].

11.

64Cu-1,4,7,10-Tetraazacyclododecane-1,4,7-β max tris(acetic acid)-10-acetate mono(N-ethylmaleimide amide)-monomeric ZHER2:477.

Shan L.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Nov 2 [updated 2011 Nov 30].

12.

68Ga-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC.

Shan L.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Nov 15 [updated 2012 Jan 4].

13.

111In-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC.

Shan L.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Nov 15 [updated 2011 Dec 21].

14.

In vivo targeting of HER2-positive tumor using 2-helix affibody molecules.

Ren G, Webster JM, Liu Z, Zhang R, Miao Z, Liu H, Gambhir SS, Syud FA, Cheng Z.

Amino Acids. 2012 Jul;43(1):405-13. doi: 10.1007/s00726-011-1096-7. Epub 2011 Oct 8.

15.

64Cu-Labeled 1,4,7,10-tetraazacyclododecane-1,4,7,10-tetraacetic acid-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC.

Shan L.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Nov 15 [updated 2011 Dec 21].

16.

18F-Labeled N-(4-fluorobenzylidene)oxime-VENK[homoC]NKEMRNRYWEAALDPNLNNQQKRAKIRSIYDDP[homoC]-NH2 with a disulfide bridge between the two homoC.

Shan L.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 Nov 15 [updated 2012 Jan 4].

17.

111In-Labeled human serum albumin–conjugated Affibody ZHER2:342 that targets the human epidermal growth factor receptor 2 (HER2).

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2011 May 19 [updated 2011 Jun 1].

18.

111In-Labeled affibody ABY-025 targeting epidermal growth factor receptor 2.

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2010 Jul 27 [updated 2010 Aug 27].

19.

[99mTc(CO)3]+-Labeled anti-epidermal growth factor receptor (HER2) affibody ZHER2:342 with a tri-(histidine-glutamate) peptide tag (HE)3 on the N-terminal.

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2010 Dec 21 [updated 2011 Jan 20].

20.

[99mTc(CO)3]+-Labeled anti-epidermal growth factor receptor (HER2) affibody ZHER2:342 with a hexa-histidine tag (H6) on the C-terminal.

Chopra A.

Molecular Imaging and Contrast Agent Database (MICAD) [Internet]. Bethesda (MD): National Center for Biotechnology Information (US); 2004-2013.
2010 Dec 20 [updated 2011 Jan 20].

Supplemental Content

Support Center