NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27368.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27368.1 Public Mus musculus 15 Osmr 21 106 86 CCDS HistoryNCBI Gene:18414Re-query CCDS DB by CCDS ID:27368.1Re-query CCDS DB by GeneID:18414See the combined annotation on chromosome 15 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27368.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022746 ENSMUSP00000022746 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022746Link to Ensembl Protein Viewer:ENSMUSP00000022746Re-query CCDS DB by Nucleotide ID:ENSMUST00000022746Re-query CCDS DB by Protein ID:ENSMUSP00000022746
Original member Current member EBI,WTSI OTTMUST00000104138 OTTMUSP00000058250 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000104138Link to Vega Protein Viewer:OTTMUSP00000058250Re-query CCDS DB by Nucleotide ID:OTTMUST00000104138Re-query CCDS DB by Protein ID:OTTMUSP00000058250
Original member Current member NCBI NM_011019.3 NP_035149.2 Accepted alive Link to Nucleotide Sequence:NM_011019.3Link to Protein Sequence:NP_035149.2Re-query CCDS DB by Nucleotide ID:NM_011019Re-query CCDS DB by Protein ID:NP_035149Link to BLink:NP_035149.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_035149.2 971 O70458-1 971 99.897% 0 1

Chromosomal Locations for CCDS 27368.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 15 (NC_000081.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 15Link to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15See the combined annotation on chromosome 15 in Sequence Viewer

Chromosome Start Stop Links
15 6815371 6815928 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6816582 6816654 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6816907 6816988 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6820921 6821088 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6822014 6822187 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6823552 6823656 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6824473 6824652 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6827089 6827311 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6828633 6828709 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6836916 6837069 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6837692 6837831 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6841953 6842104 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6842782 6842917 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6844221 6844499 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6847027 6847198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6852419 6852588 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15
15 6860293 6860365 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 15Link to Ensembl Genome Browser on chromosome 15Link to Vega Genome Browser on chromosome 15

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2916 nt):
ATGGCTTTCTCTGTGGTCCTTCATCCAGCCTTCCTCCTGGCAGTGCTGTCCCTGAGGGCATCCCGAAGCG
AA
GTCTTGGAGGAGCCTTTACCATTGACTCCTGAGATACATAAAGTTTCTTTTCAATTGAAACTTCAAGA
A
GTGAATTTAGAATGGACTGTCCCAGCCCTTACTCATGAAGAATTAAACATGATATTTCAGATAGAGATC
AGT
AGACTGAACATATCCAACACCATCTGGGTGGAGAATTATAGCACCACTGTGAAGCGTGAAGAAGCTG
TG
CGTTGGAACTGGACGTCTGATATCCCTTTGGAGTGTGTCAAACATTTCATAAGAATCAGGGCTCTGGT
A
GATGACACCAAGTCCCTTCCACAGAGTTCCTGGGGCAACTGGAGTTCCTGGAAAGAAGTTAATGCAAAG
GTT
TCCGTTGAACCTGATAAATCATTAATATTTCCTAAAGACAAAGTGTTGGAAGAAGGCTCCAATGTCA
CC
ATCTGTCTGATGTATGGGCAGAATGTATATAATGTATCCTGTAAGTTGCAAGATGAGCCAATCCATGG
A
GAACAACTTGATTCCCACGTGTCATTATTAAAATTGAACAATGTAGTTTTCCTTAGTGACACAGGGACA
AAC
ATCAATTGTCAAGCCACGAAGGGTCCTAAAAGAATATTTGGTACTGTTCTCTTTGTCTCGAAAGTGC
TC
GAGGAACCTAAGAATGTTTCCTGTGAAACCCGAGACTTTAAGACTTTGGACTGTTCATGGGAACCTGG
G
GTAGATACGACTTTGACTTGGCGTAAACAAAGATTCCAAAACTACACTTTATGTGAATCGTTCTCTAAG
AGA
TGTGAGGTTTCTAACTACAGGAACTCCTATACCTGGCAAATCACTGAAGGCTCACAGGAAATGTATA
AC
TTTACTCTCACAGCTGAAAACCAACTAAGGAAAAGAAGTGTCAACATTAATTTTAACCTGACCCATAG
A
GTTCATCCAAAGGCTCCGCAGGACGTCACCCTTAAAATTATAGGTGCTACAAAAGCCAACATGACTTGG
AAG
GTTCACTCCCATGGAAACAACTACACACTTTTGTGTCAGGTTAAACTCCAATATGGAGAAGTGATTC
AT
GAGCACAATGTTTCTGTCCACATGAGCGCAAACTACCTCTTCAGTGATCTGGATCCAGACACAAAGTA
C
AAGGCTTTTGTGCGCTGTGCAAGTGCCAACCACTTCTGGAAATGGAGCGACTGGACCCAAAAAGAGTTC
AGC
ACACCCGAGACTGCTCCCTCACAGGCTCTTGATGTATGGAGACAAGTGTGGTCGGAGAATGGAAGAC
GC
ATTGTGACTTTATTCTGGAAGCCACTATTAAAATCACAGGCCAATGGCAAAATCATATCCTATAATAT
A
GTTGTAGAAAATGAAGCCAAACCAACTGAGTCAGAACACTACTGTGTCTGGGCACCAGCCCTCAGCACA
AAC
CTGAGCCTTGACCTGCAACCTTACAAGATTCGCATCACAGCCAACAACAGCATGGGGGCATCTCCTG
AG
TCCTTGATGGTCCTTTCTAATGATTCTGGACACGAAGAGGTCAAGGAAAAGACAATTAAAGGTATAAA
G
GATGCATTCAATATTTCTTGGGAGCCCGTATCTGGAGACACGATGGGCTATGTTGTGGACTGGTGTGCA
CAT
TCCCAGGACCAACGCTGTGATTTGCAGTGGAAGAACCTTGGTCCCAATACCACAAGCACCACCATCA
CC
TCAGATGATTTTAAACCAGGCGTCCGTTACAACTTCAGAATTTTTGAAAGGTCTGTGGAACACAAAGC
T
CGGTTAGTAGAGAAACAAAGAGGATACACCCAGGAACTGGCTCCTTTGGTGAATCCAAAAGTGGAGATT
CCT
TACTCGACCCCTAACTCCTTCGTTCTAAGATGGCCAGATTATGACAGCGACTTCCAGGCTGGTTTTA
TA
AAAGGGTACCTCGTGTATGTGAAATCCAAGGAGATGCAGTGCAACCAACCCTGGGAAAGGACCCTCCT
T
CCAGATAATTCAGTCCTCTGTAAATACGACATCAATGGCTCAGAGACAAAGACACTCACCGTGGAAAAC
CTT
CAGCCAGAGTCCCTCTATGAGTTTTTCGTCACTCCGTACACCAGCGCTGGCCCAGGACCCAATGAAA
CG
TTCACAAAGGTCACAACTCCAGATGCACGCTCCCACATGCTGCTGCAGATCATACTACCCATGACCCT
C
TGCGTCTTGCTCAGCATCATTGTCTGCTACTGGAAAAGTCAGTGGGTGAAGGAGAAGTGCTACCCTGAC
ATT
CCCAATCCGTACAAGAGCAGCATTCTGTCACTCATAAAATCCAAGAAGAATCCTCACTTAATAATGA
AT
GTCAAAGACTGCATTCCAGATGTCCTTGAAGTGATAAACAAAGCAGAAGGCAGCAAGACACAGTGTGT
A
GGCTCTGGGAAACTTCACATTGAAGATGTACCCACTAAGCCGCCAATCGTGCCAACAGAAAAGGATTCC
TCA
GGGCCTGTGCCCTGCATCTTCTTTGAGAATTTTACTTACGATCAGTCAGCTTTTGACTCTGGTTCCC
AT
GGCCTCATTCCAGGTCCCCTAAAAGACACAGCACACCAACTTGGACTATTGGCTCCACCTAACAAGTT
C
CAGAACGTATTAAAAAATGACTACATGAAGCCCCTGGTCGAAAGTCCAACTGAAGAAACTAGCTTGATT
TAT
GTGTCACAGCTGGCTTCACCCATGTGCGGAGACAAGGACACGCTTGCCACAGAACCACCCGTGCCAG
TG
CATGGTTCAGAGTATAAAAGGCAAATGGTAGTTCCCGGGAGCCTCGCATCACCTTCTCTGAAGGAGGA
T
AACAGCTTGACCTCAACGGTCCTCTTAGGCCAAGGTGAACAGTAA


Translation (971 aa):
MAFSVVLHPAFLLAVLSLRASRSEVLEEPLPLTPEIHKVSFQLKLQEVNLEWTVPALTHEELNMIFQIEI
S
RLNISNTIWV
ENYSTTVKREEAVRWNWTSDIPLECVKHFIRIRALVDDTKSLPQSSWGNWSSWKEVNAK
V
SVEPDKSLIFPKDKVLEEGSNVTICLMYGQNVYNVSCKLQDEPIHGEQLDSHVSLLKLNNVVFLSDTGT
N
INCQATKGPKRIFGTVLFVS
KVLEEPKNVSCETRDFKTLDCSWEPGVDTTLTWRKQRFQNYTLCESFSK
R
CEVSNYRNSYTWQITEGSQEMYNFTLTAENQLRKRSVNINFNLTHR
VHPKAPQDVTLKIIGATKANMTW
K
VHSHGNNYTLLCQVKLQYGEVIH
EHNVSVHMSANYLFSDLDPDTKYKAFVRCASANHFWKWSDWTQKEF
S
TPET
APSQALDVWRQVWSENGRRIVTLFWKPLLKSQANGKIISYNIVVENEAKPTESEHYCVWAPALST
N
LSLDLQPYKIRITANNSMGASPESLMVLSNDSGH
EEVKEKTIKGIKDAFNISWEPVSGDTMGYVVDWCA
H
SQDQRCDLQWKNLGPNTTSTTITS
DDFKPGVRYNFRIFERSVEHKARLVEKQRGYTQELAPLVNPKVEI
P
YSTPNSFVLRWPDYDSDFQAGFIKGYLVYVKSKEMQCNQPWERTLLP
DNSVLCKYDINGSETKTLTVEN
L
QPESLYEFFVTPYTSAGPGPNETFTKVTTPDAR
SHMLLQIILPMTLCVLLSIIVCYWKSQWVKEKCYPD
I
PNPYKSSILSLIKSK
KNPHLIMNVKDCIPDVLEVINKAEGSKTQCVGSGKLHIEDVPTKPPIVPTEKDS
S
GPVPCIFFENFTYDQSAFDSGSHGLIPGPLKDTAHQLGLLAPPNKFQNVLKNDYMKPLVESPTEETSLI
Y
VSQLASPMCGDKDTLATEPPVPVHGSEYKRQMVVPGSLASPSLKEDNSLTSTVLLGQGEQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser