NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57096.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57096.1 Public Mus musculus 17 Slc29a1 21 106 86 CCDS HistoryNCBI Gene:63959Re-query CCDS DB by CCDS ID:57096.1Re-query CCDS DB by GeneID:63959See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57096.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000051574 ENSMUSP00000063096 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000051574Link to Ensembl Protein Viewer:ENSMUSP00000063096Re-query CCDS DB by Nucleotide ID:ENSMUST00000051574Re-query CCDS DB by Protein ID:ENSMUSP00000063096
Original member Current member EBI,WTSI ENSMUST00000097317 ENSMUSP00000094923 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000097317Link to Ensembl Protein Viewer:ENSMUSP00000094923Re-query CCDS DB by Nucleotide ID:ENSMUST00000097317Re-query CCDS DB by Protein ID:ENSMUSP00000094923
Original member Current member EBI,WTSI ENSMUST00000166119 ENSMUSP00000128763 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166119Link to Ensembl Protein Viewer:ENSMUSP00000128763Re-query CCDS DB by Nucleotide ID:ENSMUST00000166119Re-query CCDS DB by Protein ID:ENSMUSP00000128763
Original member Current member EBI,WTSI ENSMUST00000167692 ENSMUSP00000131976 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000167692Link to Ensembl Protein Viewer:ENSMUSP00000131976Re-query CCDS DB by Nucleotide ID:ENSMUST00000167692Re-query CCDS DB by Protein ID:ENSMUSP00000131976
Original member Current member EBI,WTSI OTTMUST00000093940 OTTMUSP00000052199 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000093940Link to Vega Protein Viewer:OTTMUSP00000052199Re-query CCDS DB by Nucleotide ID:OTTMUST00000093940Re-query CCDS DB by Protein ID:OTTMUSP00000052199
Original member Current member EBI,WTSI OTTMUST00000093945 OTTMUSP00000052204 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000093945Link to Vega Protein Viewer:OTTMUSP00000052204Re-query CCDS DB by Nucleotide ID:OTTMUST00000093945Re-query CCDS DB by Protein ID:OTTMUSP00000052204
Original member Current member EBI,WTSI OTTMUST00000093946 OTTMUSP00000052205 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000093946Link to Vega Protein Viewer:OTTMUSP00000052205Re-query CCDS DB by Nucleotide ID:OTTMUST00000093946Re-query CCDS DB by Protein ID:OTTMUSP00000052205
Original member Current member NCBI NM_001199113.1 NP_001186042.1 Accepted alive Link to Nucleotide Sequence:NM_001199113.1Link to Protein Sequence:NP_001186042.1Re-query CCDS DB by Nucleotide ID:NM_001199113Re-query CCDS DB by Protein ID:NP_001186042Link to BLink:NP_001186042.1
Original member Current member NCBI NM_001199114.1 NP_001186043.1 Accepted alive Link to Nucleotide Sequence:NM_001199114.1Link to Protein Sequence:NP_001186043.1Re-query CCDS DB by Nucleotide ID:NM_001199114Re-query CCDS DB by Protein ID:NP_001186043Link to BLink:NP_001186043.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001186042.1 460 Q9JIM1-1 460 100% 0 0
NP_001186043.1 460 Q9JIM1-1 460 100% 0 0

Chromosomal Locations for CCDS 57096.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 17Link to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 45585671 45585782 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45586094 45586305 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45587228 45587313 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45587562 45587670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45588289 45588386 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45588996 45589074 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45589208 45589305 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45589414 45589548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45589681 45589820 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45589923 45590125 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45590257 45590338 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17
17 45592179 45592207 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17Link to Vega Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1383 nt):
ATGACAACCAGTCACCAGCCTCAGGACAGGTATAAGGCAGTATGGCTTATCTTCTTTGTGCTGGGCCTGG
GG
ACACTGCTCCCCTGGAATTTTTTTATGACCGCAACCAAGTATTTCACAAACCGCCTGGACGTGTCCCA
G
AATGTGTCCTCGGACACTGATCAATCATGCGAAAGCACCAAGGCCTTGGCTGACCCCACAGTGGCCTTG
CCA
GCCCGGAGTTCTCTCAGTGCCATCTTCAACAATGTCATGACCCTGTGTGCCATGCTGCCCTTGCTGG
TC
TTCACCTGCCTCAACTCGTTTCTGCATCAGCGGATCTCTCAATCTGTTCGGATCTTGGGCAGCCTGCT
G
GCAATCCTGCTGGTATTCCTTGTCACTGCCGCCCTGGTGAAGGTGGAGATGGATGCTCTGATCTTCTTT
GTC
ATCACCATGATCAAGATTGTGCTCATCAATTCATTTGGTGCCATTTTGCAAGCCAGCCTTTTTGGTC
TG
GCAGGTGTCCTGCCAGCCAACTACACAGCCCCCATCATGAGTGGCCAGGGCCTGGCTGGCTTCTTCAC
C
TCTGTCGCCATGATCTGTGCCATTGCCAGTGGTTCTGAGCTGTCAGAAAGCGCCTTTGGCTACTTCATC
ACA
GCCTGTGCAGTTGTCATTTTGGCCATCCTGTGCTACCTGGCTCTGCCTCGGACGGAATTCTATCGCC
AT
TACCTGCAGCTCAACCTTGCGGGGCCTGCAGAGCAGGAGACCAAGTTGGATCTCATAAGTAAAGGAGA
G
GAGCCAAAAGGAAGAAGAGAGGAATCTGGGGTGCCAGGCCCCAACTCTCCACCCACCAACAGAAACCAG
TCT
ATCAAAGCCATACTTAAGAGTATCTGTGTCCCGGCTCTGTCTGTCTGCTTCATCTTCACGGTTACCA
TT
GGGTTGTTCCCTGCTGTGACTGCTGAGGTGGAATCCAGCATCGCAGGCACAAGTCCCTGGAAAAGCTA
C
TTCATTCCCGTGGCCTGTTTCTTGAATTTCAATGTCTTTGACTGGCTAGGCCGGAGCCTCACTGCTGTC
TGC
ATGTGGCCTGGCCAGGATAGCCGCTGGCTGCCGGTTTTGGTCGCCTCGAGGATTGTGTTTATTCCCC
TG
CTGATGCTCTGCAACGTGAAGGCTCGCCACTGCGGCGCGCAGCGGCACCACTTCGTCTTTAAGCATGA
C
GCCTGGTTCATCGCCTTCATGGCTGCCTTTGCCTTCTCCAATGGCTACCTCGCCAGCCTCTGCATGTGC
TTC
GGGCCCAAGAAAGTCAAACCAGCTGAGGCGGAGACAGCAGGAAACATCATGTCCTTCTTTCTGTGTC
TG
GGCCTGGCTCTGGGAGCTGTGTTGTCCTTCTTGTTAAGGGCACTTGTGTGA


Translation (460 aa):
MTTSHQPQDRYKAVWLIFFVLGLGTLLPWNFFMTATKYFTNRLDVSQNVSSDTDQSCESTKALADPTVAL
P
ARSSLSAIFNNVMTLCAMLPLLVFTCLNSFLHQ
RISQSVRILGSLLAILLVFLVTAALVKVEMDALIFF
V
ITMIKIVLIN
SFGAILQASLFGLAGVLPANYTAPIMSGQGLAGFFTSVAMICAIASGSELSESAFGYFI
T
ACAVVILAILCYLALPRT
EFYRHYLQLNLAGPAEQETKLDLISKGEEPKGRREESGVPGPNSPPTNRNQ
S
IKAILKS
ICVPALSVCFIFTVTIGLFPAVTAEVESSIAGTSPWKSYFIPVACFLNFNVFDWLGRSLTAV
C
MW
PGQDSRWLPVLVASRIVFIPLLMLCNVKARHCGAQRHHFVFKHDAWFIAFMAAFAFSNGYLASLCMC
F
GP
KKVKPAEAETAGNIMSFFLCLGLALGAVLSFLLRALV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser