NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS53542.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53542.1 Public Homo sapiens 10 DUSP13 20 108 85 CCDS HistoryNCBI Gene:51207Re-query CCDS DB by CCDS ID:53542.1Re-query CCDS DB by GeneID:51207See the combined annotation on chromosome 10 in Sequence Viewer

Public Note for CCDS 53542.1
This CCDS representation is supported by the mRNAs AY674051.1 and AY040091.1. The transcript is a candidate for nonsense-mediated mRNA decay (NMD); however, the protein is represented based on demonstration of the endogenous protein in mouse tissues in PMID:15252030, and because there are no non-NMD transcripts that can encode this protein in either human and mouse.

Public since: CCDS release 8, NCBI annotation release 37.2, Ensembl annotation release 62

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)


Attributes
Nonsense-mediated decay (NMD) candidate

Sequence IDs included in CCDS 53542.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000372702 ENSP00000361787 Accepted alive Link to Ensembl Transcript Viewer:ENST00000372702Link to Ensembl Protein Viewer:ENSP00000361787Re-query CCDS DB by Nucleotide ID:ENST00000372702Re-query CCDS DB by Protein ID:ENSP00000361787
Original member Current member EBI,WTSI OTTHUMT00000401503 OTTHUMP00000239702 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000401503Link to Vega Protein Viewer:OTTHUMP00000239702Re-query CCDS DB by Nucleotide ID:OTTHUMT00000401503Re-query CCDS DB by Protein ID:OTTHUMP00000239702
Original member Current member NCBI NM_001007271.1 NP_001007272.1 Accepted alive Link to Nucleotide Sequence:NM_001007271.1Link to Protein Sequence:NP_001007272.1Re-query CCDS DB by Nucleotide ID:NM_001007271Re-query CCDS DB by Protein ID:NP_001007272Link to BLAST:NP_001007272.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001007272.1 188 Q6B8I1-1 188 100% 0 0

Chromosomal Locations for CCDS 53542.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 10 (NC_000010.11)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10See the combined annotation on chromosome 10 in Sequence Viewer

Chromosome Start Stop Links
10 75105669 75105868 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 75107992 75108209 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10
10 75109009 75109157 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 10Link to Ensembl Genome Browser on chromosome 10Link to Vega Genome Browser on chromosome 10

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (567 nt):
ATGGCTGAGACCTCTCTCCCAGAGCTGGGGGGAGAGGACAAAGCCACGCCTTGCCCCAGCATCCTGGAGC
TG
GAGGAGCTCCTGCGGGCAGGGAAGTCTTCTTGCAGCCGTGTGGACGAAGTTTGGCCCAACCTTTTCAT
A
GGAGATGCGGCCACGGCAAACAACCGCTTTGAGCTGTGGAAGCTGGGCATCACCCACGTGCTGAACGCC
GCC
CACAAGGGCCTCTACTGTCAGGGCGGCCCTGACTTCTACGGCAGCAGTGTGAGCTACCTGGGGGTGC
CA
GCCCACGACCTCCCTGATTTTGACATCAGTGCCTACTTCTCCTCTGCGGCTGACTTCATCCACCGTGC
C
CTCAACACGCCTGGGGCCAAGGTCCTGGTGCACTGTGTGGTGGGCGTGAGCCGCTCTGCCACGCTGGTC
CTG
GCCTACCTCATGCTGCACCAGCGGCTGTCCCTGCGCCAGGCGGTGATCACCGTGAGGCAGCACCGAT
GG
GTCTTCCCCAACCGAGGCTTCCTGCACCAGCTCTGCAGGCTGGACCAGCAACTGCGGGGTGCCGGCCA
G
AGCTGA


Translation (188 aa):
MAETSLPELGGEDKATPCPSILELEELLRAGKSSCSRVDEVWPNLFIGDAATANNRFELWKLGITHVLNA
A
HKGLYCQGGPDFYGSSVSYLGVPAHDLPDFDISAYFSSAADFIHRALNTPG
AKVLVHCVVGVSRSATLV
L
AYLMLHQRLSLRQAVITVRQHRWVFPNRGFLHQLCRLDQQLRGAGQS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser