NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS27991.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
27991.1 Public Mus musculus 16 Ppm1f 21 106 86 CCDS HistoryNCBI Gene:68606Re-query CCDS DB by CCDS ID:27991.1Re-query CCDS DB by GeneID:68606See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 27991.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027373 ENSMUSP00000027373 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027373Link to Ensembl Protein Viewer:ENSMUSP00000027373Re-query CCDS DB by Nucleotide ID:ENSMUST00000027373Re-query CCDS DB by Protein ID:ENSMUSP00000027373
Original member Current member EBI,WTSI OTTMUST00000057880 OTTMUSP00000027985 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000057880Link to Vega Protein Viewer:OTTMUSP00000027985Re-query CCDS DB by Nucleotide ID:OTTMUST00000057880Re-query CCDS DB by Protein ID:OTTMUSP00000027985
Original member Current member NCBI NM_176833.4 NP_789803.1 Accepted alive Link to Nucleotide Sequence:NM_176833.4Link to Protein Sequence:NP_789803.1Re-query CCDS DB by Nucleotide ID:NM_176833Re-query CCDS DB by Protein ID:NP_789803Link to BLink:NP_789803.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_789803.1 452 Q8CGA0 452 100% 0 0

Chromosomal Locations for CCDS 27991.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 16 (NC_000082.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 16903389 16903591 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16910939 16911081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16914034 16914236 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16915160 16915348 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16917660 16917803 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16922463 16922556 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 16923640 16924022 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1359 nt):
ATGGCCTCTGGAGCCGCACAGAACAGCAGCCAGATGGCCTGTGACAGTGAGATCCCAGGCTTCCTGGACG
CA
TTCCTCCAAGACTTCCCAGCCCCACTGAGCCTGGAGAGCCCTTTGCCATGGAAGGTCCCAGGGACAGT
C
CTGAGCCAGGAAGAAGTGGAGGCTGAGCTGATTGAGCTGGCATTGGGCTTCCTGGGCAGCAGGAACGCT
CCC
CCATCGTTTGCTGTGGCTGTGACCCACGAGGCAATTTCCCAGCTGCTGCAGACAGACCTTTCTGAAT
TT
AAGAGGTTGCCTGAACAAGAGGAGGAGGAGGAAGAGGAGGAAGAAGAGAAAGCCCTCGTGACCTTACT
A
GATGCCAAAGGCCTGGCACGGAGCTTCTTCAACTGCCTTTGGAAAGTATGTAGCCAGTGGCAGAAGCAG
GTG
CCGTTGACTGCCCAGGCCCCTCAGTGGCAGTGGCTGGTCTCTATCCATGCCATCCGGAACACACGAC
GC
AAGATGGAGGACCGACACGTGTCCCTTCCTGCTTTCAACCATCTCTTCGGCTTGTCTGACTCTGTGCA
C
CGTGCCTACTTTGCTGTGTTTGATGGTCATGGAGGCGTGGATGCAGCAAGGTATGCCTCTGTCCACGTG
CAT
ACCAATGCTTCTCACCAGCCAGAGCTGCGCACAAACCCTGCAGCAGCTCTCAAAGAAGCCTTCCGGC
TC
ACCGATGAGATGTTTCTCCAGAAAGCCAAGCGAGAGCGACTGCAGAGCGGTACCACGGGTGTGTGTGC
A
CTCATCGCGGGAGCAGCCCTGCATGTTGCCTGGCTTGGAGACTCCCAGGTCATCCTGGTACAGCAAGGA
CGG
GTAGTGAAGCTGATGGAGCCGCACAAACCGGAGCGACAGGATGAGAAAGCACGAATTGAAGCCCTGG
GT
GGCTTTGTTTCTCTCATGGACTGTTGGAGAGTCAACGGGACCCTGGCAGTGTCTAGAGCCATTGGGGA
T
GTCTTCCAGAAGCCCTATGTGTCTGGGGAGGCCGATGCAGCATCCAGAGAGCTAACGGGCTCAGAGGAC
TAC
CTGTTGCTTGCTTGTGATGGTTTCTTCGATGTTGTCCCCCACCATGAAGTCACGGGTCTCGTCCATG
GC
CACTTGCTCAGGCACAAGGGCAATGGGATGCGTATTGCTGAGGAGCTGGTGGCTGTGGCCCGTGACCG
G
GGCTCCCATGACAACATTACAGTCATGGTGGTCTTCCTTAGGGAGCCCCTGGAGCTGCTAGAGGGTGGA
GTC
CAGGGGACAGGGGATGCCCAGGCAGATGTAGGAAGCCAGGACTTGTCCACTGGCCTCTCAGAACTTG
AG
ATCAGTAATACCTCACAGAGAAGCTAA


Translation (452 aa):
MASGAAQNSSQMACDSEIPGFLDAFLQDFPAPLSLESPLPWKVPGTVLSQEEVEAELIELALGFLGSRNA
P
PSFAVAVTHEAISQLLQTDLSEFKRLPEQEEEEEEEEEEKALVT
LLDAKGLARSFFNCLWKVCSQWQKQ
V
PLTAQAPQWQWLVSIHAIRNTRRKMEDRHVSLPAFNHLFGLS
DSVHRAYFAVFDGHGGVDAARYASVHV
H
TNASHQPELRTNPAAALKEAFRLTDEMFLQKAKRE
RLQSGTTGVCALIAGAALHVAWLGDSQVILVQQG
R
VVKLMEPHKPERQ
DEKARIEALGGFVSLMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRELTGSED
Y
LLLACDGFFDVVPHHEVTGLVHGHLLRHKGNGMRIAEELVAVARDRGSHDNITVMVVFLREPLELLEGG
V
QGTGDAQADVGSQDLSTGLSELEISNTSQRS




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser