NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS39617.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
39617.1 Public Mus musculus 6 A2m 21 106 86 CCDS HistoryNCBI Gene:232345Re-query CCDS DB by CCDS ID:39617.1Re-query CCDS DB by GeneID:232345See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 39617.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000032203 ENSMUSP00000032203 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000032203Link to Ensembl Protein Viewer:ENSMUSP00000032203Re-query CCDS DB by Nucleotide ID:ENSMUST00000032203Re-query CCDS DB by Protein ID:ENSMUSP00000032203
Original member Current member EBI,WTSI OTTMUST00000140274 OTTMUSP00000073543 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000140274Link to Vega Protein Viewer:OTTMUSP00000073543Re-query CCDS DB by Nucleotide ID:OTTMUST00000140274Re-query CCDS DB by Protein ID:OTTMUSP00000073543
Original member Current member NCBI NM_175628.3 NP_783327.2 Accepted alive Link to Nucleotide Sequence:NM_175628.3Link to Protein Sequence:NP_783327.2Re-query CCDS DB by Nucleotide ID:NM_175628Re-query CCDS DB by Protein ID:NP_783327Link to BLink:NP_783327.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_783327.2 1474 Q6GQT1 1474 100% 0 0

Chromosomal Locations for CCDS 39617.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 121636289 121636395 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121638276 121638459 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121639206 121639362 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121639515 121639567 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121640985 121641005 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121641272 121641440 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121641989 121642073 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121644115 121644235 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121644894 121645008 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121645152 121645261 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121646799 121646960 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121647949 121648176 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121648605 121648668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121649767 121649909 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121654465 121654614 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121657380 121657547 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121657933 121658008 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121659287 121659413 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121659920 121660148 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121660843 121660969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121661427 121661548 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121662393 121662444 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121667115 121667198 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121668046 121668222 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121668529 121668616 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121669512 121669668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121669936 121670010 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121670902 121671082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121673467 121673690 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121674731 121674949 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121675119 121675246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121676051 121676141 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121676904 121676972 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121677982 121678084 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121678519 121678560 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 121679092 121679108 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4425 nt):
ATGGGGAAGCGCTGGCTCCCAAGCCTGGCCCTGCTGCCGCTGCCGCCACCGCTGCTGCTGCTGCTGTTGC
TG
CTGCTGCCCACAAATGCCTCAGCACCACAGAAACCAATCTACATGGTGATGGTTCCCTCCCTGCTCCA
C
GCTGGCACCCCTGAGAAGGGCTGCCTCCTGTTCAACCACCTAAACGAGACAGTAACAGTGAAAGTATCC
ATG
GAGTCTGTCCGTGGGAACCAAAGCCTCTTCACTGACCTTGTTGTTGACAAGGACTTATTCCACTGTG
CC
TCCTTCATCGTCCCACAGTCTTCATCCAATGAGGTGATGTTTCTCACTGTCCAAGTAAAAGGACCAAC
T
CATGAGTTCAGGAGGAGGAGCACGGTGCTGATCAAGACTAAAGAGAGCCTGGTCTTTGCTCAGACTGAC
AAG
CCCATCTACAAACCAGGACAGATGGTGAGATTTCGTGTTGTCTCATTGGACGAAAATTTCCACCCCC
TT
AATGAATTGATTCCTCTACTGTACATTCAGGATTCAAAAAAAAATCGCATTGCACAGTGGCAGAATTT
C
CGCTTAGAGGGTGGCCTCAAACAGCTGTCCTTCCCCCTCTCCTCAGAGCCCACTCAGGGCTCCTACAAG
GTG
GTGATACGTACAGAATCAGGCAGGACCGTCGAGCACCCCTTCTCTGTGAAGGAATTTGTGCTTCCCA
AG
TTTGAAGTCAAAGTTGCAGTACCAGAGACAATCACCATCCTGGAGGAAGAGATGAATGTGTCCGTGTG
T
GGCATATACACCTATGGGAAGCCTGTTCCAGGACACGTGACTGTGAACATTTGCAGAAAGTACAGTAAT
CCT
TCTAGCTGCTTTGGTGAAGAATCGCTGGCTTTCTGTGAGAAATTCAGTCAACAGCTAGATGGCCGTG
GC
TGCTTCTCACAGCTAGTGAAAACCAAGTCTTTCCAGCTAAAGAGGCAAGAGTATGAGATGCAGCTTGA
T
GTGAATGCCAAGATCCAAGAAGAAGGAACAGGTGTGGAAGAAACCGGTAAAGGGCTCACTAAGATCACA
AGA
ACTATAACAAAACTATCATTTGTGAACGTGGATACACATTTCAGACAAGGAATTCCTTTCGTTGGGC
AG
GTGCTCCTGGTGGATGGGAGAGGCACCCCTATTCCATATGAAATGATCTTCATTGGAGCTGATGAAGC
A
AACCAGAACATAAATACTACCACTGATAAGAATGGCCTGGCACGGTTCTCCATCAACACTGATGACATC
ATG
GGCACGTCCCTAACTGTCAGGGCCAAATACAAAGATAGCAATGTCTGCTATGGATTTAGATGGTTGA
CA
GAAGAGAACGTAGAGGCTTGGCACACTGCCAACGCTGTCTTCTCACCGAGCAGAAGCTTCGTGCACCT
G
GAATCCCTGCCCTATAAACTGCGCTGTGAGCAAACCCTGGCGGTCCAGGCTCATTATATTCTAAATGAC
GAG
GCTGTGCTGGAGCGGAAGGAGTTGGTCTTCTATTATCTGATGATGGCAAAGGGAGGCATTGTTCGGG
CA
GGGACTCACGTTCTGCCTGTGACGCAGGGACACAAGAAAGGCCATTTCTCCATCCTCATCTCGATGGA
G
ACAGACCTGGCTCCTGTAGCTCGACTGGTCCTTTATACCATTCTGCCCAATGGAGAAGTGGTTGGAGAT
ACT
GTTAAATATGAGATTGAAAAGTGCCTGGCCAACAAGGTGGATTTGGTCTTCCACCCAAATATCGGTC
TT
CCGGCCACACGTGCCTTCCTCAGTGTCATGGCTTCTCCTCAGTCTCTCTGTGGCCTGCGAGCTGTGGA
C
CAAAGCGTACTGCTCACAAAGCCTGAGGCCGAACTCTCTGCATCCCTGGTTTATGATCTGCTACCAGTG
AAA
GACCTCACTGGCTTCCCTAAGGGTGTGAATCAACAGGAAGAAGACACTAATGGCTGCCTTAAGCAAA
AT
GACACTTACATTAATGGAATCCTGTACTCCCCAGTACAGAATACAAATGAAGAGGACATGTATGGCTT
C
CTAAAGGATATGGGCTTAAAGGTATTCACCAACTTGAACATCCGTAAACCCAAAGTCTGTGAACGCCTT
GGA
GTCAATAAAATACCAGCTGCATACCACCTTGTAAGCCAAGGCCACATGGATGCTTTTCTAGAGTCTT
CA
GAGTCTCCCACAGAGACTACACGAAGCTACTTCCCTGAGACGTGGATCTGGGACTTGGTGATCGTGGA
C
TCAACAGGAGTGGCTGAAATGGAAGTGACAGTCCCTGACACCATCACTGAATGGAAGGCTGGGGCCTTC
TGC
CTGTCCAATGACACTGGGTTGGGCCTCTCTCCTGTGATCGATTTCCAAGCCTTCCAGCCCTTCTTCG
TG
GATCTCACAATGCCCTACTCCGTGATCCGTGGAGAGGCCTTCACGCTCAAGGCCACTGTGCTGAACTA
C
CTCCAGACATGCATCCGGGTTGGTGTACAGCTGGAGGCCTCTCCTGATTTCCTAGCTACCCCAGAGGAG
AAG
GAACAAAAGTCTCACTGCATCTGTATGAACGAGCGGCATACCATGTCCTGGGCGGTGATCCCCAAGT
CA
TTAGGAAATGTGAATTTCACAGTGAGTGCAGAGGCACTGGACTCTAAGGAGCTGTGTAGGAATGAGGT
G
CCAGTGGTTCCTGAACGTGGAAAGAAAGACACGATCATCAAGTCCCTGCTGGTTGAACCTGAAGGTCTA
GAG
AATGAAGTGACATTCAACAGTTTGCTTTGTCCAACAGGTGCTGAGGTATCGGAACAGATATCTCTGA
AA
CTGCCATCAGATGTGGTAGAGGAATCTGCCCGAGCTTCTGTCACAGTTTTGGGAGATATATTGGGTTC
T
GCTATGCAGAACACACAGGATCTCCTTAAGATGCCCTATGGCTGTGGAGAACAGAACATGGTTCTGTTT
GCT
CCTAATATCTATGTCCTGGACTATCTGAATGAAACAGAGCAGCTGACACAGGAGATCAAGACCAAGG
CC
ATTACCTATCTCAATACGGGTTACCAAAGACAATTAAACTACAAGCACCGGGATGGCTCCTACAGTAC
T
TTTGGGGATAAACCTGGTAGGAGTCATGCCAATACCTGGCTCACAGCCTTTGTACTGAAGAGTTTTGCT
CAG
GCTCGAAGATATATCTTCATCGATGAATCACACATCACCCAAGCCCTCACCTGGCTCTCCCAGCAGC
AG
AAGGACAATGGCTGCTTCAGGAGCTCCGGGTCACTGCTCAACAATGCCATGAAGGGAGGAGTAGAAGA
T
GAAGTCACTTTGTCTGCCTACATCACCATTGCTCTCCTGGAGATGTCTCTTCCTGTCACTCATCCTGTT
GTC
CGAAATGCCCTCTTTTGCCTGGACACAGCCTGGAAGTCAGCGAGGAGAGGAGCCAGCGGCAACCATG
TC
TACACTAAGGCACTGTTGGCCTATGCATTTGCCCTTGCTGGTAACCAGGACACGAAGAAGGAGATACT
G
AAATCACTCGATGAGGAGGCGGTAAAAGAAGACAATTCTGTCCACTGGACCAGAGCTCAGAAACCCAGA
GTG
CCAGCAGATCTCTGGTACCAACCCCAGGCTCCCTCGGCTGAGGTAGAGATGACCGCTTATGTGCTCC
TG
GCTTATCTTACCACTGAGCTGGTTCCAACCCGAGAGGACCTGACTGCTGCAATGCTCATTGTGAAGTG
G
CTCACAAAGCAGCAGAATTCCCACGGTGGCTTCTCCTCCACCCAGGACACGGTAGTGGCTCTCCATGCT
TTG
TCCAAATACGGAGCAGCTACTTTCACAAGAGCGAAGAAAGCTGCACATGTGACCATCCAGTCTTCTG
GC
GCATTTTATACAAAATTCCAAGTGAACAACGACAACCAGTTATTATTACAGAGAGTCACATTGCCAAC
T
GTGCCTGGGGATTACACCGCAAAGGTAGCTGGAGAAGGGTGTGTCTACCTCCAGACATCCTTGAAATAT
AGT
GTTCTCCCGAGGGAGAAGGAGTTTCCATTTGCTTTGGTGGTGCAGACTCTGCCTGGGACTTGTGAGG
AT
CTCAAAGCTCACACCACCTTCCAGATCTCACTCAATATCAGTTACATTGGAAGCCGTTCTGACTCCAA
C
ATGGCAATTGCTGATGTGAAGATGGTGTCTGGCTTCATCCCCTTGAAACCAACAGTGAAAATGCTTGAA
AGA
TCTGTGCATGTGAGCCGGACGGAAGTCAGCAATAACCATGTCTTGATTTACTTGGATAAGGTGTCAA
AT
CAGATGCTGACCTTGTTCTTCATGGTGCAGCAAGATATTCCAGTGAGAGACCTGAAGCCAGCCATAGT
G
AAAGTCTATGATTACTACGAGAAAGATGAGTTTGCAGTTGCAAAATACAGTGCTCCCTGCAGTGCAGGT
TAT
GGAAATGCCTGA


Translation (1474 aa):
MGKRWLPSLALLPLPPPLLLLLLLLLPTNASAPQKPIYMVMVPSLLHAGTPEKGCLLFNHLNETVTVKVS
M
ESVRGNQSLFTDLVVDKDLFHCASFI
VPQSSSNEVMFLTVQVKGPTHEFRRRSTVLIKTKESLVFAQTD
K
PIYKPGQM
VRFRVVSLDENFHPLNELIPLLYIQDSKKNRIAQWQNFRLEGGLKQLSFPLSSEPTQGSYK
V
VIRTESGRTVEHPFSVKEF
VLPKFEVKVAVPETITILEEEMNVSVCGIYTYGKPVPGHVTVNICRKYSN
P
SSCFGEESLAFCEKFSQQ
LDGRGCFSQLVKTKSFQLKRQEYEMQLDVNAKIQEEGTGVEETGKGLTKIT
R
TITKLSFVNVDTHFRQGIPFVGQ
VLLVDGRGTPIPYEMIFIGADEANQNINTTTDKNGLARFSINTDDI
M
GTSLTVR
AKYKDSNVCYGFRWLTEENVEAWHTANAVFSPSRSFVHLESLPYKLRCEQTLAVQAHYILND
E
AVLERKELVFYYL
MMAKGGIVRAGTHVLPVTQGHKKGHFSILISMETDLAPVARLVLYTILPNGEVVGD
T
VKYEIEKCLANK
VDLVFHPNIGLPATRAFLSVMASPQSLCGLRAVDQSVLLTKPEAELSASLVYDLLPV
K
DLTGFPKGVNQQEEDTNGCLKQNDTYINGILYSPVQNTNEEDMYGFLK
DMGLKVFTNLNIRKPKVCERL
G
VNK
IPAAYHLVSQGHMDAFLESSESPTETTRSYFPETWIWDLVIVDSTGVAEMEVTVPDTITEWKAGAF
C
LSNDTGLGLSPVIDFQAFQPFFVDLTMPYSVIRGEAFTLKATVLNYLQTCIR
VGVQLEASPDFLATPEE
K
EQKSHCICMNERHTMSWAVIPKSL
GNVNFTVSAEALDSKELCRNEVPVVPERGKKDTIIKSLLVEPEGL
E
NEVTFNSLLCPT
GAEVSEQISLKLPSDVVEESARASVTVLGDILGSAMQNTQDLLKMPYGCGEQNMVLF
A
PNIYVLDYLNETEQLTQEIKTKAITYLNT
GYQRQLNYKHRDGSYSTFGDKPGRSHANTWLTAFVLKSFA
Q
ARRYIFIDESHITQALTWLSQQQKDNGCFRSSGSLLNNAMK
GGVEDEVTLSAYITIALLEMSLPVTHPV
V
RNALFCLDTAWKSARRGASGNHVYTKALLAYAFALAGNQDTKKEILKSLDEEAVKE
DNSVHWTRAQKPR
V
PADLWYQPQAPSAEVEMTAYVLLAYLTTELVPTREDLTAAMLIVKWLTKQQNSHGGFSSTQ
DTVVALHA
L
SKYGAATFTRAKKAAHVTIQSSGAFYTKFQVNNDNQLLLQRVTLPTVPGDYTAKVAGEGCVYLQ
TSLKY
S
VLPREKEFPFALVVQTLPGTCEDLKAHTTFQISLNI
SYIGSRSDSNMAIADVKMVSGFIPLKPTVKMLE
R
SVHVSRTEVSNNHVLIYLDK
VSNQMLTLFFMVQQDIPVRDLKPAIVKVYDYYEKDEFAVAKYSAPCSAG
Y
GNA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser