NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25787.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25787.1 Public Mus musculus 12 Adcy3 21 106 86 CCDS HistoryNCBI Gene:104111Re-query CCDS DB by CCDS ID:25787.1Re-query CCDS DB by GeneID:104111See the combined annotation on chromosome 12 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25787.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000020984 ENSMUSP00000020984 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000020984Link to Ensembl Protein Viewer:ENSMUSP00000020984Re-query CCDS DB by Nucleotide ID:ENSMUST00000020984Re-query CCDS DB by Protein ID:ENSMUSP00000020984
Original member Current member EBI,WTSI ENSMUST00000127756 ENSMUSP00000115406 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000127756Link to Ensembl Protein Viewer:ENSMUSP00000115406Re-query CCDS DB by Nucleotide ID:ENSMUST00000127756Re-query CCDS DB by Protein ID:ENSMUSP00000115406
Original member Current member EBI,WTSI OTTMUST00000084971 OTTMUSP00000045856 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000084971Link to Vega Protein Viewer:OTTMUSP00000045856Re-query CCDS DB by Nucleotide ID:OTTMUST00000084971Re-query CCDS DB by Protein ID:OTTMUSP00000045856
Original member Current member NCBI NM_138305.3 NP_612178.2 Accepted alive Link to Nucleotide Sequence:NM_138305.3Link to Protein Sequence:NP_612178.2Re-query CCDS DB by Nucleotide ID:NM_138305Re-query CCDS DB by Protein ID:NP_612178Link to BLAST:NP_612178.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_612178.2 1145 Q8VHH7 1145 100% 0 0

Chromosomal Locations for CCDS 25787.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 12 (NC_000078.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 12Link to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12See the combined annotation on chromosome 12 in Sequence Viewer

Chromosome Start Stop Links
12 4134326 4135000 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4173455 4173604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4194317 4194447 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4194866 4194977 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4195132 4195259 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4196764 4196922 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4198295 4198469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4199305 4199433 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4200902 4201044 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4201182 4201343 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4203514 4203601 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4204722 4204838 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4206365 4206624 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4206913 4206978 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4208577 4208661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4209305 4209463 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4210194 4210340 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4210772 4210891 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4211482 4211605 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4212079 4212203 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12
12 4212605 4212787 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 12Link to Ensembl Genome Browser on chromosome 12Link to Vega Genome Browser on chromosome 12

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3438 nt):
ATGCCGAGGAACCAGGGCTTCTCGGATCCCGAGTACTCGGCAGAGTACTCAGCTGAATACTCGGTCAGCC
TG
CCCTCTGACCCCGACCGCGGGGTCGGCCGGACCCATGAAATTTCTGTGCGGAACTCGGGGTCCTGCCT
G
TGCCTGCCTCGCTTTATGCGGCTGACCTTCGTGCCTGAGTCCTTGGAGAACCTCTACCAGACCTACTTC
AAA
AGGCAGCGCCATGAGACCCTGCTGGTGCTGGTGGTCTTTGCGGCCCTCTTTGACTGCTACGTGGTAG
TG
ATGTGCGCGGTGGTCTTCTCCAGCGACAAGCTGGCGCCCCTCATGGTGGCAGGCTTCGGTCTGGTGTT
G
GACATCATCCTTTTCGTGCTCTGTAAAAAGGGGCTGCTCCCGGACCGAGTGAGCCGCAAAGTGGTACCC
TAC
CTGCTGTGGCTGCTCATCTCGGCCCAGATCTTCTCCTACCTGGGCCTGAACTTTTCACGGGCCCACG
CA
GCCAGTGACACTGTGGGTTGGCAGGCTTTCTTTGTCTTCTCCTTCTTCATAACGCTGCCCCTCAGCCT
C
AGCCCCATCGTGATCATCTCTGTGGTCTCCTGTGTTGTGCACACGCTTGTGTTGGGGGTCACTGTGGCC
CAG
CAGCAGCAGGATGAGCTGGAAGGGATGCAGCTGCTGAGGGAGATCCTGGCCAACGTCTTCCTCTACC
TG
TGTGCTATCATCGTGGGCATCATGTCCTACTACATGGCAGACCGCAAGCACCGCAAGGCCTTCCTGGA
G
GCCCGCCAGTCACTGGAGGTGAAGATGAATCTGGAGGAGCAGAGCCAGCAGCAGGAAAACCTTATGCTT
TCC
ATCCTGCCCAAGCACGTGGCTGACGAGATGCTGAAGGACATGAAGAAGGACGAGAGCCAGAAGGACC
AG
CAGCAGTTCAATACCATGTACATGTACCGGCACGAGAATGTCAGCATCCTGTTTGCAGATATTGTGGG
C
TTTACCCAGCTGTCCTCTGCTTGCAGTGCCCAGGAGCTCGTGAAGTTACTCAACGAGCTCTTCGCCCGC
TTT
GACAAGCTGGCAGCCAAATACCACCAGCTGAGGATCAAGATCCTAGGCGACTGTTACTACTGCATCT
GC
GGCTTGCCTGACTACCGGGAGGACCATGCCGTGTGCTCCATCCTTATGGGGCTTGCCATGGTAGAGGC
C
ATCTCGTACGTGCGGGAGAAGACCAAGACTGGAGTGGACATGCGTGTGGGAGTGCACACAGGCACTGTC
CTA
GGCGGTGTCCTGGGCCAGAAGCGCTGGCAGTATGATGTATGGTCTACTGATGTCACCGTGGCAAACA
AG
ATGGAGGCTGGTGGCATCCCAGGGCGCGTGCACATTTCCCAGAGCACCATGGACTGCCTGAAGGGGGA
G
TTTGATGTGGAGCCTGGTGATGGGGGCAGTCGCTGCGACTACCTAGATGAGAAGGGCATCGAAACCTAC
CTC
ATCATTGCCTCCAAGCCAGAGGTGAAGAAAACAGCCCAAAATGGCCTCAACGGCTCGGCCGTGCCAA
AC
GGAGCGCCGGCATCCTCCAAACCCAGCTCCCCTGCCCTCATCGAGACCAAGGAGCCCAATGGAAGTGC
C
CATGCCAGCGGCTCCACATCAGAGGAGGCTGAAGAACAGGAGGCCCAGGCTGACAACCCCTCGTTCCCC
AAC
CCCCGCCGCAGGCTGCGCCTCCAGGACCTGGCGGACCGTGTGGTGGACGCCTCTGAGGATGAGCACG
AA
CTGAACCAGCTGCTTAATGAGGCCCTGCTGGAGCGGGAGTCCGCCCAGGTGGTAAAGAAGAGAAACAC
A
TTCCTCCTGACCATGAGGTTCATGGACCCAGAGATGGAAACACGCTACTCGGTGGAGAAGGAGAAGCAG
AGC
GGGGCTGCCTTCAGCTGCTCCTGTGTGGTCCTCTTCTGCACGGCCATGGTGGAGATACTCATTGACC
CC
TGGCTGATGACAAACTATGTGACCTTTGTGGTTGGGGAGGTTCTGCTCCTGATCCTGACCATCTGCTC
G
ATGGCTGCCATCTTTCCCAGGTCATTTCCCAAGAAGCTTGTGGCCTTCTCATCTTGGATTGACCGGACC
CGC
TGGGCAAGGAACACCTGGGCCATGTTAGCCATCTTCATTCTGGTTATGGCCAATGTTGTGGACATGC
TC
AGCTGTCTCCAGTACTACATGGGACCTTACAACATGACAGCTGGGATGGAGCTGGACGGCGGCTGCAT
G
GAGAACCCCAAGTACTACAACTACGTAGCTGTGCTGTCGCTCATCGCCACCATCATGCTGGTGCAGGTC
AGC
CACATGGTGAAGCTGACGCTCATGCTGCTCGTCACAGGCGCCGTGACTGCCCTCAACCTGTACGCCT
GG
TGTCCTGTCTTTGATGAATACGACCACAAGCGCTTTCAGGAAAAGGACTCTCCTATGGTGGCCTTAGA
G
AAGATGCAGGTACTTGCCACCCCTGGGCTCAATGGCACTGACAGCAGGCTGCCCCTGGTGCCTTCCAAG
TAC
TCCATGACTGTGATGATGTTCGTCATGATGCTGAGCTTTTACTACTTCTCGCGCCACGTGGAAAAAC
TG
GCCCGAACACTGTTCTTGTGGAAGATTGAGGTCCATGACCAGAAAGAACGTGTCTACGAGATGCGCCG
A
TGGAACGAGGCCTTGGTCACCAACATGTTGCCTGAGCATGTTGCACGCCATTTTCTGGGGTCCAAGAAG
AGA
GATGAGGAGCTGTACAGCCAGTCTTATGACGAGATTGGAGTCATGTTTGCCTCCTTGCCCAACTTTG
CT
GACTTCTACACTGAGGAGAGCATCAACAACGGCGGCATCGAGTGTCTACGCTTCCTCAATGAGATCAT
C
TCTGATTTTGACTCTCTCCTGGACAATCCCAAATTCCGGGTCATCACCAAGATCAAAACTATTGGCAGC
ACC
TATATGGCAGCTTCAGGAGTCACACCAGATGTCAACACCAATGGCTTTACAAGCTCCAGCAAGGAGG
AG
AAGTCAGACAAGGAGCGCTGGCAGCACCTGGCTGACCTGGCTGACTTTGCATTAGCCATGAAGGACAC
G
CTCACAAACATCAACAACCAGTCATTCAACAACTTCATGTTGCGCATAGGCATGAACAAAGGAGGGGTT
CTG
GCTGGCGTCATTGGAGCCCGGAAACCACACTATGACATCTGGGGCAATACGGTCAATGTGGCCAGCA
GG
ATGGAATCCACAGGAGTCATGGGCAACATCCAGGTGGTAGAAGAGACGCAGGTCATCCTTCGAGAGTA
C
GGCTTCCGCTTTGTGAGGCGAGGTCCCATCTTTGTGAAAGGCAAAGGGGAGCTTCTGACCTTTTTCTTG
AAG
GGGCGGGACAGGCCAGCTGCCTTCCCCAATGGCTCCTCTGTTACACTGCCCCACCAAGTGGTGGACA
AC
CCCTGA


Translation (1145 aa):
MPRNQGFSDPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPESLENLYQTYF
K
RQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLMVAGFGLVLDIILFVLCKKGLLPDRVSRKVVP
Y
LLWLLISAQIFSYLGLNFSRAHAASDTVGWQAFFVFSFFITLPLSLSPIVIISVVSCVVHTLVLGVTVA
Q
QQQDELEGMQLLRE
ILANVFLYLCAIIVGIMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLML
S
ILPKHVADEMLKDMKKDESQKDQQQFNTMYMYRHENV
SILFADIVGFTQLSSACSAQELVKLLNELFAR
F
DKLAA
KYHQLRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
L
GGVLGQKRWQYDVWSTDVTVANKMEAGGIP
GRVHISQSTMDCLKGEFDVEPGDGGSRCDYLDEKGIETY
L
IIASKPEVKKTAQNGLNGS
AVPNGAPASSKPSSPALIETKEPNGSAHASGSTSEEAEEQEAQADNPSFP
N
PRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESAQ
VVKKRNTFLLTMRFMDPEMETRYSVEKEKQ
S
GAAFSCSCVVLFCTAMVEILIDP
WLMTNYVTFVVGEVLLLILTICSMAAIFPRSFPKKLVAFSSWIDRT
R
WARNTWAMLAIFILVMANVVDM
LSCLQYYMGPYNMTAGMELDGGCMENPKYYNYVAVLSLIATIMLVQV
S
HMVKLTLMLLVTGAVTALNLYAWCPVFDEYDHKRFQEK
DSPMVALEKMQVLATPGLNGTDSRLPLVPSK
Y
SMTVMMFVMMLSFYYFSRH
VEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHVARHFLGSKK
R
DE
ELYSQSYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFDSLLDNPKFRVITKIKTIGS
T
YMAASGVTPDVNTNGFTSSSK
EEKSDKERWQHLADLADFALAMKDTLTNINNQSFNNFMLRIGMNKGGV
L
AGVIGARKPHYDIWGNTVNVASRMESTGVMGNIQ
VVEETQVILREYGFRFVRRGPIFVKGKGELLTFFL
K
GRDRPAAFPNGSSVTLPHQVVDNP




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser