NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS25720.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
25720.1 Public Mus musculus 11 Rptor 21 106 86 CCDS HistoryNCBI Gene:74370Re-query CCDS DB by CCDS ID:25720.1Re-query CCDS DB by GeneID:74370See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 25720.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000026671 ENSMUSP00000026671 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000026671Link to Ensembl Protein Viewer:ENSMUSP00000026671Re-query CCDS DB by Nucleotide ID:ENSMUST00000026671Re-query CCDS DB by Protein ID:ENSMUSP00000026671
Original member Current member EBI,WTSI OTTMUST00000008948 OTTMUSP00000004362 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000008948Link to Vega Protein Viewer:OTTMUSP00000004362Re-query CCDS DB by Nucleotide ID:OTTMUST00000008948Re-query CCDS DB by Protein ID:OTTMUSP00000004362
Original member Current member NCBI NM_028898.3 NP_083174.2 Accepted alive Link to Nucleotide Sequence:NM_028898.3Link to Protein Sequence:NP_083174.2Re-query CCDS DB by Nucleotide ID:NM_028898Re-query CCDS DB by Protein ID:NP_083174Link to BLink:NP_083174.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_083174.2 1335 Q8K4Q0-1 1335 99.9251% 0 1

Chromosomal Locations for CCDS 25720.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 119603810 119603971 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119657664 119657766 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119671278 119671360 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119725010 119725168 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119743867 119744013 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119756239 119756414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119780543 119780602 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119798769 119798869 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119799322 119799466 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119811945 119812020 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119817078 119817179 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119821661 119821744 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119822911 119823021 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119843682 119843756 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119846358 119846423 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119846753 119846944 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119851327 119851467 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119856267 119856384 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119857313 119857453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119857836 119857994 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119865552 119865670 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119871495 119871598 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119872216 119872399 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119874154 119874264 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119884924 119885029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119887037 119887151 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119888542 119888666 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119891114 119891218 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119892552 119892658 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119894256 119894383 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119894919 119895005 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119895903 119896019 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119896420 119896549 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 119897414 119897482 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (4008 nt):
ATGGAGTCGGAGATGCTGCAGTCGCCTCTTATGGGACTCGGGGAGGAAGATGAGGCGGACCTTACAGATT
GG
AACTTGCCTTTGGCTTTTATGAAGAAAAGACATTGTGAGAAAATCGAAGGCTCCAAATCTTTAGCGCA
G
AGCTGGAGAATGAAGGATCGGATGAAGACGGTGAGTGTGGCCTTGGTCCTGTGCCTGAATGTGGGTGTG
GAT
CCTCCGGATGTGGTGAAGACCACACCCTGTGCTCGGCTGGAATGCTGGATCGATCCTCTGTCTATGG
GC
CCTCAGAAAGCTCTGGAAACCATCGGTGCAAACCTACAGAAGCAGTATGAGAACTGGCAGCCAAGGGC
T
CGGTACAAGCAGAGCCTCGACCCTACTGTGGATGAAGTCAAGAAACTTTGCACATCTCTGCGCCGGAAC
GCC
AAGGAGGAACGGGTCCTTTTCCACTACAATGGCCACGGGGTGCCCAGGCCTACAGTGAATGGAGAGG
TC
TGGGTCTTCAACAAGAACTACACTCAGTACATCCCTCTGTCCATATACGACCTGCAGACGTGGATGGG
C
AGCCCATCCATCTTTGTCTACGACTGTTCCAATGCTGGCCTCATCGTCAAGTCCTTCAAACAGTTTGCA
CTG
CAGAGGGAGCAGGAACTAGAGGTAGCTGCGATTAACCCAAACCATCCACTTGCCCAGATGCCCTTGC
CT
CCCTCAATGAAAAACTGCATCCAGTTGGCAGCGTGTGAGGCACACGAGCTGCTGCCCATGATCCCTGA
C
CTCCCAGCCGACCTGTTCACATCCTGCCTCACCACTCCCATCAAGATTGCTCTGCGCTGGTTTTGCATG
CAG
AAGTGCGTGAGTCTGGTGCCTGGAGTCACACTGGATTTGATAGAAAAGATCCCTGGCCGGCTGAATG
AC
CGGAGGACCCCTCTGGGAGAGCTGAACTGGATCTTCACAGCCATCACAGATACCATCGCCTGGAATGT
G
CTCCCTCGGGATCTCTTCCAAAAGCTTTTCCGACAGGACCTGCTCGTGGCAAGTTTGTTTAGAAATTTT
TTA
TTGGCAGAAAGAATCATGAGGTCATATAACTGCACCCCAGTAAGCAGCCCGCGGCTCCCCCCGACAT
AC
ATGCATGCCATGTGGCAGGCCTGGGACCTTGCTGTGGACATTTGCCTCTCTCAGCTGCCAACCATCAT
C
GAAGAGGGTACTGCCTTCAGGCACAGCCCATTCTTTGCCGAGCAGCTGACAGCATTCCAGGTGTGGCTC
ACA
ATGGGTGTGGAAAACAGGAGCCCCCCAGAGCAGCTGCCCATCGTCCTGCAGGTGCTGCTAAGCCAGG
TG
CACCGGCTGAGAGCATTGGACTTGCTGGGACGGTTTTTGGACTTGGGCCCTTGGGCGGTGAGCTTGGC
C
CTGTCGGTGGGCATCTTCCCCTATGTACTGAAGCTGCTTCAGAGCTCAGCCCGAGAGCTTCGGCCACTC
CTT
GTCTTCATCTGGGCCAAAATCCTCGCTGTCGACAGTTCGTGCCAAGCTGACCTCGTGAAGGACAACG
GT
CACAAGTACTTCCTATCCGTCTTGGCAGACCCATACATGCCAGCTGAACATAGGACCATGACAGCCTT
C
ATTCTTGCTGTAATCGTCAACAGCTACACAACAGGGCAAGAGGCCTGCCTCCAGGGAAACCTGATTGCC
ATC
TGTCTGGAGCAGCTCAGCGACCCACACCCCTTGCTACGCCAGTGGGTGGCCATTTGCCTGGGAAGGA
TC
TGGCAGAACTTCGACTCTGCAAGATGGTGTGGGGTGAGAGACAGTGCCCACGAAAAGCTCTATAGCCT
C
CTCTCTGACCCCATCCCTGAGGTCCGATGTGCAGCTGTATTTGCCCTGGGCACCTTTGTGGGAAATTCT
GCT
GAGAGGACAGACCACTCTACCACCATTGACCACAATGTGGCCATGATGCTGGCTCAGCTGATCAATG
AT
GGAAGCCCCATGGTCCGGAAGGAGCTGGTGGTGGCTCTGAGTCACCTTGTAGTCCAATATGAAAGCAA
T
TTCTGCACTGTGGCCCTGCAGTTCATGGAGGAAGAAAAGAACTACCCTTTGCCTTCTCCAGCAGCCACA
G
AG
GGAGGGAGCTTGACCCCAGTTCGAGACAGCCCATGCACCCCCAGACTCCGTTCAGTGAGCTCCTATG
GG
AACATCCGAGCCGTCACGACAGCTAGGAACCTGAACAAATCTTTGCAGAATCTGAGCTTGACGGAAGA
A
TCGGGCAGCTCAGTGGCCTTCTCTCCCGGGAACCTCAGCACCAGCAGCAGTGCCAGCAGCACCTTGGGG
AGC
CCTGAGAACGAGGAGTACATCCTGTCCTTCGAGACCATCGACAAGATGCGGCGTGTGAGCTCCTACT
CA
GCGCTCAACTCCCTCATAGGAGTTTCTTTTAATAGTGTTTACACTCAAATTTGGAGAGTCTTACTGCA
T
CTGGCTGCTGATCCCTATCCAGATGTTTCTGATTTAGCCATGAAAGTCCTCAACAGCATTGCTTACAAG
GCC
ACAGTGAACGCCCGGCCCCAACGAATCCTTGACACATCCTCTCTCACACAGTCGGCCCCAGCCAGCC
CA
ACCAACAAGGGCATGCACATGCACCAGGTGGGAGGCTCCCCGCCAGCATCTAGCACCAGCAGCTGCAG
C
CTGACCAATGATGTGGCCAAGCAGACTGTCAGCCGTGACCTGCCTTCCAGCCGCCCGGGTACTGCCGGC
CCC
ACAGGGGCACAGTACACCCCTCACTCCCACCAGTTCCCTCGAACACGAAAGATGTTTGACAAAGGCC
CT
GATCAGACCACAGATGATGCAGATGATGCTGCCGGACACAAGAGCTTCATTTGTGCCTCTATGCAGAC
A
GGGTTCTGTGACTGGAGTGCCCGCTACTTTGCCCAGCCAGTCATGAAGATCCCCGAGGAGCATGACCTA
GAG
AGTCAGATCCGCAAGGAGCGTGAGTGGCGGTTCCTGAGGAACACTCGAGTCAGGAAGCAGGCTCAGC
AG
GTCATCCAGAAGGGCATCACCAGACTGGACGATCAGATCTTTCTGAACAGGAACCCCGGCGTTCCTTC
T
GTGGTCAAATTCCATCCCTTTACACCATGCATAGCTGTCGCCGACAAGGACAGCATCTGTTTTTGGGAC
TGG
GAGAAAGGAGAGAAGCTGGACTATTTCCACAATGGCAACCCTCGGTACACCAGGGTCACCGCCATGG
AG
TACCTGAATGGTCAGGACTGTTCCTTGCTGCTGACAGCCACAGATGATGGTGCCATCAGGGTCTGGAA
G
AATTTTGCTGATTTGGAAAAGAATCCAGAGATGGTGACTGCGTGGCAAGGGCTCTCAGACATGCTTCCA
ACA
ACACGAGGAGCTGGGATGGTGGTAGACTGGGAACAAGAAACTGGCCTTCTCATGAGCTCAGGGGACG
TG
CGCATTGTCAGGATCTGGGATACTGACCGGGAGACGAAGGTGCAGGACATCCCCACGGGTGCTGACAG
C
TGTGTGACAAGTCTGTCTTGTGATTCGCACCGTTCGCTCATTGTGGCTGGCCTGGGTGATGGCTCGATC
CGT
GTCTACGACAGGAGGATGGCACTCAGTGAATGCCGGGTCATGACTTACCGAGAGCACACAGCGTGGG
TG
GTAAAGGCCTACCTGCAGAAGCACCCTGAGGGCCACATCGTGAGTGTGAGTGTCAATGGAGATGTGCG
C
TTCTTCGACCCTCGGATGCCCGAGTCTGTGAATGTAATGCAGATTGTGAAGGGGCTGACAGCCCTGGAC
ATC
CACCCCCAGGCAAACCTGATCGCCTGTGGCTCCATGAACCAGTTCACAGCCATCTACAACGGAAATG
GA
GAGCTGATCAACAACATCAAATACTATGATGGCTTCATGGGCCAGCGAGTCGGGGCCATCAGCTGCCT
G
GCTTTCCACCCACACTGGCCTCATCTGGCCGTAGGAAGCAATGACTACTACATTTCCGTGTATTCGGTG
GAG
AAGCGTGTCAGATAG


Translation (1335 aa):
MESEMLQSPLMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSVALVLCLNVGV
D
PPDVVKTTPCARLECWI
DPLSMGPQKALETIGANLQKQYENWQPRARYKQSLDPTVDEVKKLCTSLRRN
A
KEERVLFHYNGHGVPRPTVNGEVWVFNK
NYTQYIPLSIYDLQTWMGSPSIFVYDCSNAGLIVKSFKQFA
L
QREQELE
VAAINPNHPLAQMPLPPSMKNCIQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCM
Q
KCVSLVPGVTLDLIE
KIPGRLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNF
L
LAERIMRSYNCTPVSSPRLPPTYMHAM
WQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
T
MGVENRSPPEQLPIVLQ
VLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLLQSSARELRPL
L
VFIWAKILAVDS
SCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILAVIVNSYTTGQEACLQGNLIA
I
CLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSAHEKLYSLLSDPIPE
VRCAAVFALGTFVGNS
A
ERTDHSTTIDHNVAMMLAQLINDGSPMVRK
ELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAAT
E
GGSLTPVRDSPCTPRLRSVSSYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLG
S
PENEEYILSFETIDKMRRVSSYSALNSLI
GVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
A
TVNARPQRILDTSSLTQSAPASPTNKGMHMHQV
GGSPPASSTSSCSLTNDVAKQTVSRDLPSSRPGTAG
P
TGAQYTPHSHQFPRTRKMFDKGPDQ
TTDDADDAAGHKSFICASMQTGFCDWSARYFAQPVMKIPEEHDL
E
SQIRKEREWRFLRNTRVRKQAQQVIQK
GITRLDDQIFLNRNPGVPSVVKFHPFTPCIAVADKDSICFWD
W
EKGEKLDYFHNGNPRYTRVTAMEYLNGQDCSLLLTAT
DDGAIRVWKNFADLEKNPEMVTAWQGLSDMLP
T
TR
GAGMVVDWEQETGLLMSSGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSI
R
VYDRRMALSE
CRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALD
I
HPQANLIA
CGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGSNDYYISVYSV
E
KRVR




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser