NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30188.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30188.1 Public Mus musculus X Gabrq 21 106 86 CCDS HistoryNCBI Gene:57249Re-query CCDS DB by CCDS ID:30188.1Re-query CCDS DB by GeneID:57249See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30188.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033711 ENSMUSP00000033711 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033711Link to Ensembl Protein Viewer:ENSMUSP00000033711Re-query CCDS DB by Nucleotide ID:ENSMUST00000033711Re-query CCDS DB by Protein ID:ENSMUSP00000033711
Original member Current member EBI,WTSI OTTMUST00000043205 OTTMUSP00000019435 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043205Link to Vega Protein Viewer:OTTMUSP00000019435Re-query CCDS DB by Nucleotide ID:OTTMUST00000043205Re-query CCDS DB by Protein ID:OTTMUSP00000019435
Original member Current member NCBI NM_020488.2 NP_065234.1 Accepted alive Link to Nucleotide Sequence:NM_020488.2Link to Protein Sequence:NP_065234.1Re-query CCDS DB by Nucleotide ID:NM_020488Re-query CCDS DB by Protein ID:NP_065234Link to BLink:NP_065234.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_065234.1 638 Q9JLF1 638 100% 0 0

Chromosomal Locations for CCDS 30188.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 72825456 72825604 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72827550 72827638 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72831657 72831724 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72833208 72833428 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72835093 72835175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72835657 72835791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72836156 72836308 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72836801 72837057 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 72837720 72838481 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1917 nt):
ATGGGCATCCGAGGTATGCTGCGAGCCGCTGCGCTCCTGCTGCTCATTAGGACTTGGCTGGCAGAGAGTA
AC
GGCCCCAGTCCCACCCCGAAATTCCACTTCGAGCTCTCCTCCAGCACGCCTGAAGTCATTCTGGATCT
C
TTCAACTGCAAAAACTGTGCAAATGAAGCTGTGGTTCAAAAGATTTTGGACAGGGTGCTGTCAACATAT
GAT
GTCCGACTTAGACCAAATTTTGGAGGAGCTCCTGTGCCTGTGTCAGTATCTATCTATGTGTCCAGTA
TT
GAACAGATCTCAGAAATAAATATGGACTATACAATCACAATGTTTTTGCATCAGACCTGGAAGGACAC
A
CGCTTAGCTTACTATGAAACCAACCTAAACCTGACCCTGGATTATCGGATGCATGAGAAGCTCTGGGTT
CCT
GACTGCTACTTTGTGAATAGCAAAGATGCCTTTGTGCATGATGTAACTGTGGAGAATCGTGTATTTC
AA
CTTCACCCAGATGGGACAGTGCGATATGGCATCCGACTTACCACAACAGCAGCCTGTTCCCTGGATCT
G
CAAAAATTCCCTATGGACAAACAATCCTGCAAGCTGGAGGTGGAGAGCTATGGCTACACTGTCGAAGAC
ATT
GTGTTATCCTGGGAAGATGATAATGCCATCCACATTACTGATGGGCTGCATATCCCTCAGTACACGT
AC
CTGGGGAGAACAATTACCAGCAAGGAAGTGTACTTCTACACAGGCTCCTACATGCGCCTGATAGTGAA
G
TTCCAGGTTCAGAGGGAAGTCCGCAGTTACCTTGTGCAGGTCTATTGGCCCACGGTCCTCACCACCATT
CTC
TCCTGGATATCATTTTGGATGAACTATGATTCCTCTGCAGCCAGGGTAACTATTGGACTAACTTCGA
TC
CTTGTCCTGACTACCATCGACTCACATATGCGGGATAAACTCCCCCATATTTCCTGTATCAAAGCTAT
T
GACATCTACATCCTTGTATGCCTATTCTTCGTTTTCCTGTCACTGCTGGAGTATGTCTACATCAACTAC
CTT
TTCTTCAGCCAAGTACCTCGGCGTAATCACAGAAGATGCAGGAAACCCAGGAGAGTTGTTGCCCGAT
AC
CGCTACCAAGAAGTGGTGGTAGCAAATGTGCAGGATGGCCTGATTAATGTGGAAGACAGAGTAGAAGA
C
AGAGCTGGTCCCCTTCCTGACAGCCCCATGCAGGCTCATCTGGCAAGCCAGGAAAGTCTAGGATCCTTG
GTG
TTCACATCAGAGCAGGCCCAGCTGGCTACCTCAGAAAGTCTCAGTCTACTCTCTTCTGCCTCAAGCC
AG
ACTCAATTGGCCACTGGAGAAAGCCTGAGTGATCTGCCCTCCACCTCTGAGCAAACAGTGCCTGAGTG
T
ACCATTCACTTTCATGGCTTTCTTACTAATGACAGTATTATCCCCATCAAAATCCACAGCCGATCTGAT
GCC
TGTGATGATGAAGACTCCGAAGAAAGCCTAAGCTCTGAGGAGAGCCATGGCCATGGAAGCAGCCACA
CT
GGAAGGCTCAAGCTCCAGATTAGCCAGAGGTGTGTGCAAGAAGCAAGTTGGGACCTTGATAAAATTGA
G
ATCTTACAGGATGACATCAGTATCACGAGCAGCTGGCTTGGCCTTGATGAACAATGCAAGGGGGATGCT
GAC
AGTATCTGGAGCCTTACTGATGAGGAGCTCATGGCCTGTGACCAAGAGAAGGACAGTAGCTCAGAGT
CT
GAGGAGAATTGCTCCCCAAGCCCTGGGTGCTCCTTCAATGAAGGGTTCTCTTTTCAGCTCTTTAAACC
T
AACCGGGTCCCCAAGGTTGATAGATGGTCCCGTTTCCTCTTTCCTCTTTCCTTTGGGCTGTTCAATGTG
GTT
TACTGGTTATACCATGTCTATTAG


Translation (638 aa):
MGIRGMLRAAALLLLIRTWLAESNGPSPTPKFHFELSSSTPEVILDLFNCKNCANEAVVQKILDRVLSTY
D
VRLRPNFG
GAPVPVSVSIYVSSIEQISEINMDYTITMFLHQTWKDTRLAYYETNLNLTLDYRMHEKLWV
P
DCYFVNSKDAFVHDVTVENRVFQLHPDGTVRYGI
RLTTTAACSLDLQKFPMDKQSCKLEVESYGYTVED
I
VLSWEDDNAIHITDGLHIPQYTYLGRTITSKEVYFYT
GSYMRLIVKFQVQREVRSYLVQVYWPTVLTTI
L
SWISFWMNYDSSAARVTI
GLTSILVLTTIDSHMRDKLPHISCIKAIDIYILVCLFFVFLSLLEYVYINY
L
FFSQVPRRNHRRCRKPRRVVARYRYQEVVVANVQ
DGLINVEDRVEDRAGPLPDSPMQAHLASQESLGSL
V
FTSEQAQLATSESLSLLSSASSQTQLATGESLSDLPSTSEQTVPECTIHFHGFLTNDSIIPIKIHSRSD
A
CDDEDSEESLSSEESHGHGSSHTGRLKLQISQRCVQEASWDLDKIEILQDDISITSSWLGLDEQCKGDA
D
SIWSLTDEELMACDQEKDSSSESEENCSPSPGCSFNEGFSFQLFKPNRVPKVDRWSRFLFPLSFGLFNV
V
YWLYHVY




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser