NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS10721.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
10721.1 Public Homo sapiens 16 VPS35 20 108 85 CCDS HistoryNCBI Gene:55737Re-query CCDS DB by CCDS ID:10721.1Re-query CCDS DB by GeneID:55737See the combined annotation on chromosome 16 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 10721.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000299138 ENSP00000299138 Accepted alive Link to Ensembl Transcript Viewer:ENST00000299138Link to Ensembl Protein Viewer:ENSP00000299138Re-query CCDS DB by Nucleotide ID:ENST00000299138Re-query CCDS DB by Protein ID:ENSP00000299138
Original member Current member EBI,WTSI OTTHUMT00000255742 OTTHUMP00000163364 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000255742Link to Vega Protein Viewer:OTTHUMP00000163364Re-query CCDS DB by Nucleotide ID:OTTHUMT00000255742Re-query CCDS DB by Protein ID:OTTHUMP00000163364
Original member Current member NCBI NM_018206.5 NP_060676.2 Accepted alive Link to Nucleotide Sequence:NM_018206.5Link to Protein Sequence:NP_060676.2Re-query CCDS DB by Nucleotide ID:NM_018206Re-query CCDS DB by Protein ID:NP_060676Link to BLink:NP_060676.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_060676.2 796 Q96QK1 796 100% 0 0

Chromosomal Locations for CCDS 10721.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '-' strand of Chromosome 16 (NC_000016.10)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 16Link to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16See the combined annotation on chromosome 16 in Sequence Viewer

Chromosome Start Stop Links
16 46660472 46660651 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46661718 46661861 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46662243 46662482 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46662983 46663162 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46668930 46669052 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46671705 46671860 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46672265 46672472 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46674314 46674462 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46674564 46674660 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46676583 46676692 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46677315 46677398 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46678943 46679156 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46680671 46680853 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46681377 46681500 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46682079 46682175 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46683508 46683606 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16
16 46689131 46689133 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 16Link to Ensembl Genome Browser on chromosome 16Link to Vega Genome Browser on chromosome 16

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2391 nt):
ATGCCTACAACACAGCAGTCCCCTCAGGATGAGCAGGAAAAGCTCTTGGATGAAGCCATACAGGCTGTGA
AG
GTCCAGTCATTCCAAATGAAGAGATGCCTGGACAAAAACAAGCTTATGGATGCTCTAAAACATGCTTC
T
AATATGCTTGGTGAACTCCGGACTTCTATGTTATCACCAAAGAGTTACTATGAACTTTATATGGCCATT
TCT
GATGAACTGCACTACTTGGAGGTCTACCTGACAGATGAGTTTGCTAAAGGAAGGAAAGTGGCAGATC
TC
TACGAACTTGTACAGTATGCTGGAAACATTATCCCAAGGCTTTACCTTTTGATCACAGTTGGAGTTGT
A
TATGTCAAGTCATTTCCTCAGTCCAGGAAGGATATTTTGAAAGATTTGGTAGAAATGTGCCGTGGTGTG
CAA
CATCCCTTGAGGGGTCTGTTTCTTCGAAATTACCTTCTTCAGTGTACCAGAAATATCTTACCTGATG
AA
GGAGAGCCAACAGATGAAGAAACAACTGGTGACATCAGTGATTCCATGGATTTTGTACTGCTCAACTT
T
GCAGAAATGAACAAGCTCTGGGTGCGAATGCAGCATCAGGGACATAGCCGAGATAGAGAAAAAAGAGAA
CGA
GAAAGACAAGAACTGAGAATTTTAGTGGGAACAAATTTGGTGCGCCTCAGTCAGTTGGAAGGTGTAA
AT
GTGGAACGTTACAAACAGATTGTTTTGACTGGCATATTGGAGCAAGTTGTAAACTGTAGGGATGCTTT
G
GCTCAAGAATATCTCATGGAGTGTATTATTCAGGTTTTCCCTGATGAATTTCACCTCCAGACTTTGAAT
CCT
TTTCTTCGGGCCTGTGCTGAGTTACACCAGAATGTAAATGTGAAGAACATAATCATTGCTTTAATTG
AT
AGATTAGCTTTATTTGCTCACCGTGAAGATGGACCTGGAATCCCAGCGGATATTAAACTTTTTGATAT
A
TTTTCACAGCAGGTGGCTACAGTGATACAGTCTAGACAAGACATGCCTTCAGAGGATGTTGTATCTTTA
CAA
GTCTCTCTGATTAATCTTGCCATGAAATGTTACCCTGATCGTGTGGACTATGTTGATAAAGTTCTAG
AA
ACAACAGTGGAGATATTCAATAAGCTCAACCTTGAACATATTGCTACCAGTAGTGCAGTTTCAAAGGA
A
CTCACCAGACTTTTGAAAATACCAGTTGACACTTACAACAATATTTTAACAGTCTTGAAATTAAAACAT
TTT
CACCCACTCTTTGAGTACTTTGACTACGAGTCCAGAAAGAGCATGAGTTGTTATGTGCTTAGTAATG
TT
CTGGATTATAACACAGAAATTGTCTCTCAAGACCAGGTGGATTCCATAATGAATTTGGTATCCACGTT
G
ATTCAAGATCAGCCAGATCAACCTGTAGAAGACCCTGATCCAGAAGATTTTGCTGATGAGCAGAGCCTT
GTG
GGCCGCTTCATTCATCTGCTGCGCTCTGAGGACCCTGACCAGCAGTACTTGATTTTGAACACAGCAC
GA
AAACATTTTGGAGCTGGTGGAAATCAGCGGATTCGCTTCACACTGCCACCTTTGGTATTTGCAGCTTA
C
CAGCTGGCTTTTCGATATAAAGAGAATTCTAAAGTGGATGACAAATGGGAAAAGAAATGCCAGAAGATT
TTT
TCATTTGCCCACCAGACTATCAGTGCTTTGATCAAAGCAGAGCTGGCAGAATTGCCCTTAAGACTTT
TT
CTTCAAGGAGCACTAGCTGCTGGGGAAATTGGTTTTGAAAATCATGAGACAGTCGCATATGAATTCAT
G
TCCCAGGCATTTTCTCTGTATGAAGATGAAATCAGCGATTCCAAAGCACAGCTAGCTGCCATCACCTTG
ATC
ATTGGCACTTTTGAAAGGATGAAGTGCTTCAGTGAAGAGAATCACGAACCTCTGAGGACTCAGTGTG
CC
CTTGCTGCATCCAAACTTCTAAAGAAACCTGATCAGGGCCGAGCTGTGAGCACCTGTGCACATCTCTT
C
TGGTCTGGCAGAAACACGGACAAAAATGGGGAGGAGCTTCACGGAGGCAAGAGGGTAATGGAGTGCCTA
AAA
AAAGCTCTAAAAATAGCAAATCAGTGCATGGACCCCTCTCTACAAGTGCAGCTTTTTATAGAAATTC
TG
AACAGATATATCTATTTTTATGAAAAGGAAAATGATGCGGTAACAATTCAGGTTTTAAACCAGCTTAT
C
CAAAAGATTCGAGAAGACCTCCCGAATCTTGAATCCAGTGAAGAAACAGAGCAGATTAACAAACATTTT
CAT
AACACACTGGAGCATTTGCGCTTGCGGCGGGAATCACCAGAATCCGAGGGGCCAATTTATGAAGGTC
TC
ATCCTTTAA


Translation (796 aa):
MPTTQQSPQDEQEKLLDEAIQAVKVQSFQMKRCLDKNKLMDALKHASNMLGELRTSMLSPKSYYELYMAI
S
DELHYLEVYLTDEFAKGRKVADLYELVQYAGNIIPR
LYLLITVGVVYVKSFPQSRKDILKDLVEMCRGV
Q
HPLRGLFLRNYLLQCTRNILPDEGEPT
DEETTGDISDSMDFVLLNFAEMNKLWVRMQHQGHSRDREKRE
R
ERQELRILVGTNLVRLSQLEGVNVERYKQ
IVLTGILEQVVNCRDALAQEYLMECIIQVFPDEFHLQTLN
P
FLRACAELHQNVNVKNIIIALID
RLALFAHREDGPGIPADIKLFDIFSQQVATVIQSRQDMPSEDVVSL
Q
VSLINLAMKCYPDRVDYVDKVLETTVEIFNKLNLE
HIATSSAVSKELTRLLKIPVDTYNNILTVLKLKH
F
HPLFEYFDYESRKSMSCYVLSNVLDYNTEIVSQDQ
VDSIMNLVSTLIQDQPDQPVEDPDPEDFADEQSL
V
GRFIHLLRSEDPDQQYL
ILNTARKHFGAGGNQRIRFTLPPLVFAAYQLAFRYKENSKVDDKWEKKCQKI
F
SFAHQTISALIKAELAELPLRLFLQGALAAGEIGFENHETVAYEFMSQ
AFSLYEDEISDSKAQLAAITL
I
IGTFERMKCFSEENHEPLRTQCALAASKLLKKPDQGRAVSTCAHLFWSGRNTDKNGEE
LHGGKRVMECL
K
KALKIANQCMDPSLQVQLFIEILNRYIYFYEKENDA
VTIQVLNQLIQKIREDLPNLESSEETEQINKHF
H
NTLEHLRLRRESPESEGPIYEGLIL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser