NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS53167.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
53167.1 Public Mus musculus X Abcb7 21 106 86 CCDS HistoryNCBI Gene:11306Re-query CCDS DB by CCDS ID:53167.1Re-query CCDS DB by GeneID:11306See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 53167.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000033695 ENSMUSP00000033695 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000033695Link to Ensembl Protein Viewer:ENSMUSP00000033695Re-query CCDS DB by Nucleotide ID:ENSMUST00000033695Re-query CCDS DB by Protein ID:ENSMUSP00000033695
Original member Current member EBI,WTSI OTTMUST00000043710 OTTMUSP00000019632 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043710Link to Vega Protein Viewer:OTTMUSP00000019632Re-query CCDS DB by Nucleotide ID:OTTMUST00000043710Re-query CCDS DB by Protein ID:OTTMUSP00000019632
Original member Current member NCBI NM_009592.1 NP_033722.1 Accepted alive Link to Nucleotide Sequence:NM_009592.1Link to Protein Sequence:NP_033722.1Re-query CCDS DB by Nucleotide ID:NM_009592Re-query CCDS DB by Protein ID:NP_033722Link to BLink:NP_033722.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033722.1 752 Q61102 752 100% 0 0

Chromosomal Locations for CCDS 53167.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 104284043 104284258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104291123 104291230 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104294468 104294571 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104295831 104296002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104299769 104299898 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104300050 104300213 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104300771 104300928 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104301794 104301968 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104302952 104303039 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104303129 104303217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104304132 104304400 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104305270 104305402 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104323334 104323453 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104342494 104342580 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104344925 104345002 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 104413657 104413824 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2259 nt):
ATGGCGCTGCTCGCGATACATTCCTGGCGCTGGGCAGCCGCGGCGGTCGCTTTCGAAAAGCACAAGCATT
CG
GCAGTTCTGACCCGGGCTCTAGTCTCCATGTGCGGCTCAGGCCCGCGATGGAGTTCGTCCCAGCGCGG
C
GCGTCAGGAAGCGCTCGGCTGTCCCAGACTACAGAATCATTAAGAAATACTACACAGCAGAGATGGGGA
AAA
GACAACTCCAGACAGTTACTAGATGCTACAAAGGCTCTCCAGACATGGCCATTGATAGAAAAGAGAA
CA
TGTTGGCATGGGCACGCAGGAGGAGGACTCCACACAGACCCAAAAGAAGGGTTAAAGGATGTTGATAC
T
AGAAAAATCATCAAAGCCATGCTTTCTTATGTGTGGCCTGAAGATAGGCCAGATCTACGAGCCAGAGTT
GCC
ATCTCCCTGGGATTTTTGGGTGGTGCAAAGGCCATGAATATTGTGGTTCCTTTCATGTTTAAATATG
CT
GTAGACAGCCTCAACCAGATGTCGGGAAACATGCTGAACCTGAGTGATGCACCAAATACAGTTGCAAC
C
ATGGCAACAGCAGTTCTGATTGGCTATGGTGTATCAAGAGCCGGAGCTGCCTTTTTCAATGAAGTTCGA
AAT
GCAGTATTTGGCAAAGTAGCACAAAATTCAATACGAAGAATAGCCAAAAATGTATTTCTCCATCTCC
AC
AACTTGGATCTGGGTTTCCATCTGAGCAGACAGACAGGAGCTTTATCTAAGGCTATTGACAGAGGAAC
A
AGGGGCATTAGTTTTGTCCTCAGTGCGTTAGTATTTAATCTTCTCCCTATTGTGTTTGAGATGATGCTT
GTC
AGTAGTGTTTTGTATTACAAATGTGGTGCCCAGTTTGCATTGGTAACCCTAGGAACACTTGGTGCAT
AT
ACAGCATTCACAGTTGCAGTTACACGGTGGAGAACTAGATTTAGAATAGAAATGAACAAAGCAGATAA
C
GATGCAGGTAATGCTGCTATCGACTCACTGCTGAATTATGAAACTGTGAAGTATTTTAATAATGAAAAA
TAT
GAAGCACAAAGATATGATGGATTCCTGAAGACATATGAGACTGCTTCATTGAAAAGTACCTCTACTC
TG
GCAATGCTGAATTTTGGCCAAAATGCTATTTTCAGTGTCGGATTAACAGCTATAATGGTGCTTGCCAG
T
CAGGGAATTGTGGCAGGTGCCCTTACTGTTGGAGATCTAGTGATGGTGAATGGACTGCTTTTTCAACTG
TCA
TTACCCCTTAACTTCCTGGGAACTGTATATAGAGAGACAAGACAAGCACTCATAGATATGAACACCT
TG
TTTACTCTGCTCAAGGTAGACACACGGATTAAAGACAAAGTGATGGCACCTCCCCTTCAAATAACACC
A
CAGACAGCCACGGTGGCCTTTGATAATGTGCATTTTGAATACATCGAAGGACAGAAAGTCCTTAATGGA
GTA
TCTTTTGAAGTCCCTGCAGGAAAGAAAGTGGCCATTGTAGGAGGTAGTGGGTCAGGAAAAAGCACGA
TA
GTGAGGCTGCTGTTTCGCTTCTATGAGCCTCAAAAGGGTAGCATTTACCTTGCTGGTCAAAATTTACA
A
GATGTGAGCCTGGAAAGTCTTCGGCGGGCAGTGGGAGTAGTACCTCAGGATGCTGTCCTCTTCCATAAT
ACC
ATCTACTACAACCTCTTATATGGAAACATCAATGCTTCACCTGAGGAAGTATATGCAGTCGCAAAAT
TA
GCTGGTCTTCATGATGCAATTCTTCGAATGCCACATGGATATGACACACAAGTAGGAGAACGAGGACT
C
AAGCTATCAGGCGGAGAAAAGCAGAGGGTAGCAATTGCAAGAGCCATTTTGAAGAATCCCCCAGTTATT
CTC
TATGATGAAGCTACTTCATCATTAGATTCAATTACTGAAGAGACTATTCTTGGTGCCATGAGAGATG
TG
GTCAAGCACAGAACTTCTATTTTCATTGCACATAGATTGTCAACAGTGGTTGATGCAGATGAAATCAT
T
GTCCTGAGCCAGGGGAAGGTAGCTGAACGTGGTACCCACTATGGTCTGCTTGCTAACTCTAGCAGTATC
TAT
TCAGAGATGTGGCATACACAGAGCAACCGTGTACAGAACCAGGATAGCCTCGGATGGGATGCAAAGA
AA
GAGAGTCTCTCCAAAGAGGAGGAAAGAAAGAAGCTCCAAGAAGAAATTGTCAACAGTGTGAAAGGCTG
T
GGAAATTGTTCCTGCTAA


Translation (752 aa):
MALLAIHSWRWAAAAVAFEKHKHSAVLTRALVSMCGSGPRWSSSQRGASGSARLSQTTESLRNTTQQRWG
K
DNSRQLLDATK
ALQTWPLIEKRTCWHGHAGGGLHTDPKEGLKDVDTRKIIKAMLSYVWPEDRPDLRARV
A
ISLGFLGGAK
AMNIVVPFMFKYAVDSLNQMSGNMLNLSDAPNTVATMATAVLIGYGVSRAGAAFFNEVR
N
AVFGKVAQNSIRRIAKNVFLHLHNLDLGFHLSRQTGALSKAIDRGTRGISFVLSALVFNLLPIVFEMML
V
SSVL
YYKCGAQFALVTLGTLGAYTAFTVAVTRWRTRFRIEMNKADNDAGNAAIDSLLNYETVKYFNNEK
Y
EAQRYDGFLKTYETASLKSTSTLAMLNFGQNAIFSVGLTAIMVLASQGIVA
GALTVGDLVMVNGLLFQL
S
LPLNFLGTVYRETRQALIDMNTLFTLLKVDTRIK
DKVMAPPLQITPQTATVAFDNVHFEYIEGQKVLNG
V
SFEVPAGKKVAIVGGSGS
GKSTIVRLLFRFYEPQKGSIYLAGQNLQDVSLESLRRAVGVVPQDAVLFHN
T
IYYNLLYGNINASPEEVYAVAKLAGLHDAILRMPHGYDTQVGERGLKLS
GGEKQRVAIARAILKNPPVI
L
YDEATSSLDSITEE
TILGAMRDVVKHRTSIFIAHRLSTVVDADEIIVLSQGKVAERGTHYGLLANSSSI
Y
SEMWHTQSNRVQNQDSLGWDAKKESLSKEEERKKLQEEIVNSVKGCGNCSC




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser