NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS56628.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
56628.1 Public Mus musculus 1 Stat1 21 106 86 CCDS HistoryNCBI Gene:20846Re-query CCDS DB by CCDS ID:56628.1Re-query CCDS DB by GeneID:20846See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 56628.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000070968 ENSMUSP00000066743 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000070968Link to Ensembl Protein Viewer:ENSMUSP00000066743Re-query CCDS DB by Nucleotide ID:ENSMUST00000070968Re-query CCDS DB by Protein ID:ENSMUSP00000066743
Original member Current member EBI,WTSI ENSMUST00000186857 ENSMUSP00000140875 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000186857Link to Ensembl Protein Viewer:ENSMUSP00000140875Re-query CCDS DB by Nucleotide ID:ENSMUST00000186857Re-query CCDS DB by Protein ID:ENSMUSP00000140875
Original member Current member EBI,WTSI OTTMUST00000121361 OTTMUSP00000066906 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000121361Link to Vega Protein Viewer:OTTMUSP00000066906Re-query CCDS DB by Nucleotide ID:OTTMUST00000121361Re-query CCDS DB by Protein ID:OTTMUSP00000066906
Original member Current member EBI,WTSI OTTMUST00000121559 OTTMUSP00000066947 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000121559Link to Vega Protein Viewer:OTTMUSP00000066947Re-query CCDS DB by Nucleotide ID:OTTMUST00000121559Re-query CCDS DB by Protein ID:OTTMUSP00000066947
Original member Current member NCBI NM_001205314.1 NP_001192243.1 Accepted alive Link to Nucleotide Sequence:NM_001205314.1Link to Protein Sequence:NP_001192243.1Re-query CCDS DB by Nucleotide ID:NM_001205314Re-query CCDS DB by Protein ID:NP_001192243Link to BLink:NP_001192243.1
Original member Current member NCBI NM_009283.4 NP_033309.3 Accepted alive Link to Nucleotide Sequence:NM_009283.4Link to Protein Sequence:NP_033309.3Re-query CCDS DB by Nucleotide ID:NM_009283Re-query CCDS DB by Protein ID:NP_033309Link to BLink:NP_033309.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001192243.1 749 P42225 749 98.5314% 0 11
NP_033309.3 749 P42225 749 98.5314% 0 11

Chromosomal Locations for CCDS 56628.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 52122594 52122721 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52123114 52123258 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52126520 52126618 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52132544 52132633 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52135603 52135681 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52136879 52136970 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52137279 52137430 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52139194 52139352 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52140577 52140669 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52142901 52142960 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52144086 52144115 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52144204 52144297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52145150 52145191 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52147294 52147377 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52147901 52147999 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52148903 52149038 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52150619 52150668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52151238 52151332 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52152233 52152378 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52153844 52154029 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52154986 52155061 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52155983 52156082 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 52159283 52159297 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2250 nt):
ATGTCACAGTGGTTCGAGCTTCAGCAGCTGGACTCCAAGTTCCTGGAGCAGGTCCACCAGCTGTACGATG
AC
AGTTTCCCCATGGAAATCAGACAGTACCTGGCCCAGTGGCTGGAAAAGCAAGACTGGGAGCACGCTGC
C
TATGATGTCTCGTTTGCGACCATCCGCTTCCATGACCTCCTCTCACAGCTGGACGACCAGTACAGCCGC
TTT
TCTCTGGAGAATAATTTCTTGTTGCAGCACAACATACGGAAAAGCAAGCGTAATCTCCAGGATAACT
TC
CAAGAAGATCCCGTACAGATGTCCATGATCATCTACAACTGTCTGAAGGAAGAAAGGAAGATTTTGGA
A
AATGCCCAAAGATTTAATCAGGCCCAGGAGGGAAATATTCAGAACACTGTGATGTTAGATAAACAGAAG
GAG
CTGGACAGTAAAGTCAGAAATGTGAAGGATCAAGTCATGTGCATAGAGCAGGAAATCAAGACCCTAG
AA
GAATTACAAGATGAATATGACTTTAAATGCAAAACCTCTCAGAACAGAGAAGGTGAAGCCAATGGTGT
G
GCGAAGAGCGACCAAAAACAGGAACAGCTGCTGCTCCACAAGATGTTTTTAATGCTTGACAATAAGAGA
AAG
GAGATAATTCACAAAATCAGAGAGTTGCTGAATTCCATCGAGCTCACTCAGAACACTCTGATTAATG
AC
GAGCTCGTGGAGTGGAAGCGAAGGCAGCAGAGCGCCTGCATCGGGGGACCGCCCAACGCCTGCCTGGA
T
CAGCTGCAAAGCTGGTTCACCATTGTTGCAGAGACCCTGCAGCAGATCCGTCAGCAGCTTAAAAAGCTG
GAG
GAGTTGGAACAGAAATTCACCTATGAGCCCGACCCTATTACAAAAAACAAGCAGGTGTTGTCAGATC
GA
ACCTTCCTCCTCTTCCAGCAGCTCATTCAGAGCTCCTTCGTGGTAGAACGACAGCCGTGCATGCCCAC
T
CACCCGCAGAGGCCCCTGGTCTTGAAGACTGGGGTACAGTTCACTGTCAAGCTGAGACTGTTGGTGAAA
TTG
CAAGAGCTGAACTATAACTTGAAAGTGAAAGTCTCATTTGACAAAGATGTGAACGAGAAAAACACAG
TT
AAAGGATTTCGGAAGTTCAACATCTTGGGTACGCACACAAAAGTGATGAACATGGAAGAATCCACCAA
C
GGAAGTCTGGCAGCTGAGTTCCGACACCTGCAACTGAAGGAACAGAAAAACGCTGGGAACAGAACTAAT
GAG
GGGCCTCTCATTGTCACCGAAGAACTTCACTCTCTTAGCTTTGAAACCCAGTTGTGCCAGCCAGGCT
TG
GTGATTGACCTGGAGACCACCTCTCTTCCTGTCGTGGTGATCTCCAACGTCAGCCAGCTCCCCAGTGG
C
TGGGCGTCTATCCTGTGGTACAACATGCTGGTGACAGAGCCCAGGAATCTCTCCTTCTTCCTGAACCCC
CCG
TGCGCGTGGTGGTCCCAGCTCTCAGAGGTGTTGAGTTGGCAGTTTTCATCAGTCACCAAGAGAGGTC
TG
AACGCAGACCAGCTGAGCATGCTGGGAGAGAAGCTGCTGGGCCCTAATGCTGGCCCTGATGGTCTTAT
T
CCATGGACAAGGTTTTGTAAGGAAAATATTAATGATAAAAATTTCTCCTTCTGGCCTTGGATTGACACC
ATC
CTAGAGCTCATTAAGAAGCACCTGCTGTGCCTCTGGAATGATGGGTGCATTATGGGCTTCATCAGCA
AG
GAGCGAGAACGCGCTCTGCTCAAGGACCAGCAGCCAGGGACGTTCCTGCTTAGATTCAGTGAGAGCTC
C
CGGGAAGGGGCCATCACATTCACATGGGTGGAACGGTCCCAGAACGGAGGTGAACCTGACTTCCATGCC
GTG
GAGCCCTACACGAAAAAAGAACTTTCAGCTGTTACTTTCCCAGATATTATTCGCAACTACAAAGTCA
TG
GCTGCCGAGAACATACCAGAGAATCCCCTGAAGTATCTGTACCCCAATATTGACAAAGACCACGCCTT
T
GGGAAGTATTATTCCAGACCAAAGGAAGCACCAGAACCGATGGAGCTTGACGACCCTAAGCGAACTGGA
TAC
ATCAAGACTGAGTTGATTTCTGTGTCTGAAGTCCACCCTTCTAGACTTCAGACCACAGACAACCTGC
TT
CCCATGTCTCCAGAGGAGTTTGATGAGATGTCCCGGATAGTGGGCCCCGAATTTGACAGTATGATGAG
C
ACAGTATAA


Translation (749 aa):
MSQWFELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAAYDVSFATIRFHDLLSQLDDQYSR
F
SLENNFLLQHNIRKSKRNLQ
DNFQEDPVQMSMIIYNCLKEERKILENAQRFNQAQEGNIQNTVMLDKQK
E
LDSKVRNVKDQVM
CIEQEIKTLEELQDEYDFKCKTSQNREGEANGVAKSDQKQEQLLLHKMFLMLDNKR
K
EIIHKIRELLNSIELTQNTLINDELVEWKRRQQSACIGGPPNACLDQLQSWFTIVAETLQQIRQQLKKL
E
ELEQKFTYEPDPITKNKQVLSDRTFLLFQQLIQ
SSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVK
L
QELNYNLKVKVSFD
KDVNEKNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
E
GPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTEPRNLSFFLNP
P
CAWWSQLSEVLSWQFSSVTKRGLNADQLSMLGEKLL
GPNAGPDGLIPWTRFCKENINDKNFSFWPWIDT
I
LELIKKHLLCLWND
GCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHA
V
EPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKE
APEPMELDDPKRTG
Y
IKTELISVSE
VHPSRLQTTDNLLPMSPEEFDEMSRIVGPEFDSMMSTV



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser