NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17381.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17381.1 Public Mus musculus 3 Mme 21 106 86 CCDS HistoryNCBI Gene:17380Re-query CCDS DB by CCDS ID:17381.1Re-query CCDS DB by GeneID:17380See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17381.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029400 ENSMUSP00000029400 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029400Link to Ensembl Protein Viewer:ENSMUSP00000029400Re-query CCDS DB by Nucleotide ID:ENSMUST00000029400Re-query CCDS DB by Protein ID:ENSMUSP00000029400
Original member Current member EBI,WTSI ENSMUST00000194150 ENSMUSP00000141544 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000194150Link to Ensembl Protein Viewer:ENSMUSP00000141544Re-query CCDS DB by Nucleotide ID:ENSMUST00000194150Re-query CCDS DB by Protein ID:ENSMUSP00000141544
Original member Current member EBI,WTSI ENSMUST00000194134 ENSMUSP00000142205 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000194134Link to Ensembl Protein Viewer:ENSMUSP00000142205Re-query CCDS DB by Nucleotide ID:ENSMUST00000194134Re-query CCDS DB by Protein ID:ENSMUSP00000142205
Original member Current member EBI,WTSI OTTMUST00000130649 OTTMUSP00000069987 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000130649Link to Vega Protein Viewer:OTTMUSP00000069987Re-query CCDS DB by Nucleotide ID:OTTMUST00000130649Re-query CCDS DB by Protein ID:OTTMUSP00000069987
Original member Current member EBI,WTSI OTTMUST00000130650 OTTMUSP00000069988 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000130650Link to Vega Protein Viewer:OTTMUSP00000069988Re-query CCDS DB by Nucleotide ID:OTTMUST00000130650Re-query CCDS DB by Protein ID:OTTMUSP00000069988
Original member Current member EBI,WTSI OTTMUST00000130651 OTTMUSP00000069989 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000130651Link to Vega Protein Viewer:OTTMUSP00000069989Re-query CCDS DB by Nucleotide ID:OTTMUST00000130651Re-query CCDS DB by Protein ID:OTTMUSP00000069989
Original member Current member NCBI NM_001289462.1 NP_001276391.1 Accepted alive Link to Nucleotide Sequence:NM_001289462.1Link to Protein Sequence:NP_001276391.1Re-query CCDS DB by Nucleotide ID:NM_001289462Re-query CCDS DB by Protein ID:NP_001276391Link to BLink:NP_001276391.1
Original member Current member NCBI NM_001289463.1 NP_001276392.1 Accepted alive Link to Nucleotide Sequence:NM_001289463.1Link to Protein Sequence:NP_001276392.1Re-query CCDS DB by Nucleotide ID:NM_001289463Re-query CCDS DB by Protein ID:NP_001276392Link to BLink:NP_001276392.1
Original member Current member NCBI NM_008604.4 NP_032630.2 Accepted alive Link to Nucleotide Sequence:NM_008604.4Link to Protein Sequence:NP_032630.2Re-query CCDS DB by Nucleotide ID:NM_008604Re-query CCDS DB by Protein ID:NP_032630Link to BLink:NP_032630.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001276391.1 750 Q61391 750 100% 0 0
NP_001276392.1 750 Q61391 750 100% 0 0
NP_032630.2 750 Q61391 750 100% 0 0

Chromosomal Locations for CCDS 17381.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 3Link to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 63300135 63300294 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63300979 63301014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63326714 63326875 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63327785 63327865 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63327972 63328067 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63328170 63328288 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63329650 63329715 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63340016 63340150 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63341907 63342008 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63343497 63343633 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63343742 63343835 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63345125 63345253 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63346054 63346152 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63347137 63347217 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63348618 63348721 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63358906 63358964 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63361932 63362051 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63364762 63364895 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63364997 63365062 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63368479 63368574 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63368880 63368956 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3
3 63380233 63380332 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2253 nt):
ATGGGAAGATCAGAAAGTCAGATGGATATAACTGATATCAATGCTCCAAAGCCAAAGAAGAAACAGCGAT
GG
ACTCCCCTGGAGATCAGCCTCTCTGTGCTTGTCTTGCTCCTGACTATCATAGCGGTGACAATGATCGC
T
CTCTATGCAACCTATGATGATGGCATTTGCAAATCATCAGACTGCATAAAATCAGCTGCTCGACTGATT
CAG
AATATGGATGCCTCTGTTGAGCCATGTACAGACTTCTTCAAGTATGCTTGTGGAGGCTGGTTGAAAC
GC
AACGTCATTCCCGAGACCAGTTCCCGATACAGTAATTTTGACATTTTAAGAGATGAGCTAGAAGTCAT
T
TTGAAAGATGTCCTTCAAGAACCCAAAACTGAAGACATAGTAGCAGTGCAGAAAGCAAAAACCTTGTAC
AGA
TCGTGTATAAATGAGTCTGCTATTGATAGCAGAGGCGGACAACCTCTACTCAAACTGTTACCAGATA
TA
TATGGGTGGCCAGTAGCATCAGATAACTGGGATCAAACATATGGCACTTCTTGGACAGCTGAGAAATC
C
ATTGCACAACTGAATTCTAAATATGGGAAAAAGGTCCTCATTAATTTTTTTGTTGGCACTGATGATAAG
AAT
TCTACCCAGCATATAATTCATTTTGACCAGCCTCGACTTGGCCTCCCTTCCAGAGACTACTATGAGT
GC
ACTGGAATATATAAAGAGGCTTGCACAGCATATGTGGATTTTATGATTTCTGTGGCCAGACTGATTCG
T
CAGGAACAAAGTTTGCCTATTGATGAAAACCAGCTCTCTTTGGAAATGAATAAAGTTATGGAATTGGAA
AAA
GAAATTGCCAATGCTACAACTAAACCAGAAGACCGAAATGACCCAATGCTGCTTTATAACAAAATGA
CA
TTGGCCAAGCTGCAGAACAACTTTTCCCTGGAGGTCAATGGGAAGTCATTCAGCTGGTCAAATTTCAC
A
AATGAAATCATGTCAACTGTGAATATTAATATTCAAAATGAGGAAGAAGTTGTTGTCTATGCTCCAGAA
TAT
TTAACCAAACTTAAGCCTATTCTTACCAAATATTCTCCCAGAGATCTTCAAAATTTAATGTCCTGGA
GG
TTCATAATGGATCTTGTAAGCAGCCTCAGCCGAAACTACAAGGAGTCCAGAAATGCTTTCCGCAAGGC
C
CTTTATGGGACTACATCAGAAACTGCAACATGGAGACGGTGTGCTAACTACGTCAATGGGAATATGGAG
AAT
GCTGTGGGGAGGCTTTATGTGGAAGCGGCTTTTGCTGGAGAGAGCAAGCACGTGGTTGAAGACTTGA
TT
GCACAAATCCGGGAAGTTTTTATTCAGACTTTGGATGACCTTACTTGGATGGATGCTGAGACAAAAAA
G
AAAGCTGAAGAAAAGGCCTTGGCAATTAAAGAAAGGATTGGCTATCCTGATGACATCATTTCCAATGAG
AAC
AAACTGAATAATGAGTATCTTGAGTTGAACTACAGGGAAGATGAATACTTTGAGAACATAATTCAAA
AT
TTGAAATTCAGCCAAAGCAAGCAGCTAAAGAAGCTCCGAGAAAAAGTGGACAAAGATGAGTGGATAAG
T
GGAGCAGCTGTAGTCAATGCATTTTATTCCTCAGGCCGAAATCAGATAGTCTTCCCCGCTGGCATTTTG
CAG
CCCCCATTCTTCAGTGCTCAGCAATCCAACTCATTGAACTATGGGGGCATCGGCATGGTCATTGGAC
AT
GAAATCACACATGGATTTGATGACAATGGAAGAAATTTCAATAAAGATGGAGACCTCGTTGACTGGTG
G
ACGCAGCAGTCGGCAAATAATTTTAAAGACCAATCCCAGTGTATGGTATACCAGTATGGAAACTTTTCC
TGG
GACCTAGCAGGTGGACAGCATCTCAATGGAATTAATACACTAGGAGAAAACATTGCTGATAATGGAG
GT
ATTGGCCAAGCATACAGAGCCTATCAGAATTATGTTAAAAAGAATGGTGAAGAAAAATTACTCCCTGG
A
CTTGACCTCAATCACAAACAACTATTTTTCCTGAACTTTGCCCAGGTGTGGTGTGGGACCTACCGGCCA
GAG
TATGCAGTCAATTCTATTAAAACAGATGTACACAGTCCTGGAAATTTCAGGATCATTGGGACTTTGC
AG
AACTCTGCCGAGTTTGCAGATGCCTTTCATTGCCGCAAGAATTCATACATGAATCCAGAAAGGAAATG
T
CGGGTTTGGTGA


Translation (750 aa):
MGRSESQMDITDINAPKPKKKQRWTPLEISLSVLVLLLTIIAVTMIALYATYDDGICKSSDCIKSAARLI
Q
NMDASVEPCTDFFKYACGGWLKRNVIPETSSRYSNFDILRDELEVILK
DVLQEPKTEDIVAVQKAKTLY
R
SCINE
SAIDSRGGQPLLKLLPDIYGWPVASDNWDQTYGTSWTAEKSIAQLNSKYGKKVLINFFVGTDDK
N
STQHIIH
FDQPRLGLPSRDYYECTGIYKEACTAYVDFMISVARLIRQEQSLPIDENQLSLEMNKVMELE
K
EIAN
ATTKPEDRNDPMLLYNKMTLAKLQNNFSLEVNGKSFSWSNFTNEIMSTVNINIQNEEEVVVYAPE
Y
LTKLKPILTKYSP
RDLQNLMSWRFIMDLVSSLSRNYKESRNAFRKALYGTTSETATWRRCANYVNGNME
N
AVGRLYVEAAFAGESKHV
VEDLIAQIREVFIQTLDDLTWMDAETKKKAEEKALAIKERIGYPDDIISNE
N
KLNNEYLE
LNYREDEYFENIIQNLKFSQSKQLKKLREKVDKDEWISGAAVVNAFYSSGRNQIVFPAGIL
Q
PPFFSAQQSNSLNYGGIGMVIGHEITHGFDDN
GRNFNKDGDLVDWWTQQSANNFKDQSQCMVYQYGNFS
W
DLAGGQH
LNGINTLGENIADNGGIGQAYRAYQNYVKKNGEEKLLPGLDLNHKQLFFLNFAQVWCGTYRP
E
YAVNSIKTDVHSPGNF
RIIGTLQNSAEFADAFHCRKNSYMNPERKCRVW



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser