NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29084.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29084.1 Public Mus musculus 18 Dsg2 19 105 81 CCDS HistoryNCBI Gene:13511Re-query CCDS DB by CCDS ID:29084.1Re-query CCDS DB by GeneID:13511See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Sequence IDs included in CCDS 29084.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000059787 ENSMUSP00000057096 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000059787Link to Ensembl Protein Viewer:ENSMUSP00000057096Re-query CCDS DB by Nucleotide ID:ENSMUST00000059787Re-query CCDS DB by Protein ID:ENSMUSP00000057096
Original member Current member EBI,WTSI OTTMUST00000074515 OTTMUSP00000038847 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000074515Link to Vega Protein Viewer:OTTMUSP00000038847Re-query CCDS DB by Nucleotide ID:OTTMUST00000074515Re-query CCDS DB by Protein ID:OTTMUSP00000038847
Original member NCBI NM_007883.2 NP_031909.2 Updated not alive Link to Nucleotide Sequence:NM_007883.2Link to Protein Sequence:NP_031909.2Re-query CCDS DB by Nucleotide ID:NM_007883Re-query CCDS DB by Protein ID:NP_031909
Current member NCBI NM_007883.3 NP_031909.2 Accepted alive Link to Nucleotide Sequence:NM_007883.3Link to Protein Sequence:NP_031909.2Re-query CCDS DB by Nucleotide ID:NM_007883Re-query CCDS DB by Protein ID:NP_031909Link to BLink:NP_031909.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031909.2 1122 O55111 1122 100% 0 0

Chromosomal Locations for CCDS 29084.1

Assembly GRCm38.p3 (GCF_000001635.23)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 18Link to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 20558285 20558344 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20573489 20573524 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20574940 20575074 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20579040 20579201 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20579334 20579478 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20580512 20580678 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20582708 20582845 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20582937 20583122 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20589948 20590213 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20591834 20591976 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20592272 20592499 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20594064 20594291 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20595960 20596081 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20598339 20598668 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18
18 20601313 20602335 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18Link to Vega Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3369 nt):
ATGGCGCGGAGCCCGGGTGACCGGTGCGCCCTGCTGCTGCTGGTGCAGCTGCTGGCGGTGGTCTGCTTGG
AC
TTTGGAAACGGACTTCACTTAGAGGTCTTCAGCCCAAGAAATGAAGGCAAACCGTTCCCTAAGCACAC
T
CACTTGGTTCGTCAAAAGAGGGCCTGGATCACTGCCCCTGTGGCTCTGCGGGAGGGCGAAGACCTGTCC
AGA
AAGAACCCGATTGCCAAGATACACTCTGACCTTGCAGAAGAAAAAGGGATAAAAATCACGTACAAGT
AC
ACTGGGAAGGGAATTACAGAACCGCCTTTCGGCATATTCGTCTTTGATAGAAACACAGGAGAACTGAA
C
ATCACTAGCATTCTTGACCGGGAAGAAACACCATATTTTCTGCTGACAGGCTATGCATTGGACTCCAGA
GGA
AACAACCTGGAAAAGCCCTTGGAACTACGCATCAAAGTTCTGGACATCAATGACAACGAGCCAGTGT
TC
ACACAGGAGGTCTTTGTTGGGTCCATTGAGGAATTGAGTGCAGCACATACACTTGTGATGAAAATCAC
C
GCCACAGATGCAGATGACCCGGAGACTCTGAATGCTAAAGTCTCCTACAGAATTGTCTCTCAGGAGCCT
GCA
AATAGTCATATGTTCTACCTAAATAAAGACACGGGGGAGATCTATACGACCAGTTTTACTTTGGACA
GA
GAGGAACACAGCAGCTATTCCTTGACGGTGGAAGCAAGAGATGGTAACGGGCAGATAACAGACAAGCC
A
GTCCAGCAAGCTCAAGTTCAGATCCGTATATTGGATGTCAATGACAATATACCTGTGGTAGAAAACAAA
ATG
TATGAGGGGACAGTGGAAGAAAACCAGGTCAATGTAGAAGTCATGCGGATCAAAGTGACCGATGCAG
AT
GAAGTGGGCTCTGATAACTGGCTAGCAAACTTTACATTTGCATCAGGAAATGAAGGGGGCTATTTCCA
C
ATTGAGACTGACACACAGACTAATGAAGGGATTGTGACCCTTGTCAAGGAAGTGGACTATGAAGAAATG
AAG
AAGCTAGACTTGAGCATCATTGTCACTAACAAAGCAGCTTTCCACAAGTCCATTCTGAGCAAGTACA
AG
GCCACGCCCATTCCCATCACTGTCAAGGTCAAGAACGTGGTTGAAGGCATTCATTTCAAGAGCAGCGT
A
GTCTCTTTCCGAGCTAGTGAGGCAATGGATAGATCCAGCCTCAGCAGGTCGATTGGAAATTTTCAAGTT
TTT
GATGAAGACACTGGTCAAGCAGCTAAAGTAACATATGTAAAAGTGCAAGACACTGACAACTGGGTCT
CT
GTGGACTCCGTCACTTCAGAGATTAAGCTTGTAAAGATTCCTGACTTTGAATCTAGATATGTCCAAAA
T
GGTACCTACACTGCAAAGGTTGTGGCCATATCCAAAGAACATCCTCAAAAAACCATCACTGGCACCATC
GTT
ATCACTGTTGAAGACGTCAATGACAATTGTCCCGTGCTGGTGGACTCTGTACGGAGTGTCTGTGAGG
AT
GAACCATATGTGAATGTCACTGCAGAGGATTTGGATGGGGCCCAGAACAGTGCGCCATTCAGCTTCTC
C
ATCATTGACCAGCCTCCTGGAACGGCACAGAAGTGGAAAATAACGCACCAGGAAAGTACCAGTGTGCTG
CTG
CAGCAGAGCGAGCGGAAACGCGGGAGAAGTGAGATTCCCTTCCTCATTTCCGACAGCCAGGGCTTCA
GC
TGCCCCGAAAGGCAGGTCCTTCAGCTCACTGTATGCGAGTGTCTGAAGGGCGGTGGCTGTGTGGCTGC
A
CAGTATGACAACTACGTCGGGTTGGGCCCTGCCGCCATCGCTCTCATGATTCTAGCACTCCTGCTCCTG
CTC
CTGGTGCCGCTCTTGCTGTTGATATGCCACTGTGGAGGGGGCGCCAAAGGCTTCACCCCCATTCCTG
GG
ACAATAGAGATGCTGCACCCTTGGAATAATGAAGGGGCACCTCCTGAGGACAAGGTGGTGCCATCGCT
T
CTGGTGGCCGATCATGCAGAGAGCTCGGCAGTGAGAGGCGGCGTAGGAGGTGCGATGCTCAAGGAAGGC
ATG
ATGAAAGGCAGCAGCTCAGCTTCCGTTACCAAAGGGCAGCATGAGCTGTCTGAGGTTGACGGAAGAT
GG
GAAGAACACAGAAGCCTCCTCACCGCTGGGGCCACTCACCATGTAAGGACAGCAGGAACCATCGCTGC
C
AACGAAGCCGTAAGGACAAGAGCCACGGGGTCTTCCAGAGACATGAGTGGGGCTCGAGGAGCCGTTGCC
GTG
AATGAGGAATTCTTAAGAAGTTACTTCACAGAGAAAGCGGCCTCCTACAATGGGGAAGACGACCTTC
AC
ATGGCCAAAGACTGCCTTCTCGTTTACTCTCAGGAAGACACGGCCTCCCTCCGAGGCTCGGTCGGGTG
C
TGCAGTTTCATCGAGGGAGAACTCGATGACCTGTTCCTGGATGATCTTGGCCTTAAATTCAAGACCCTA
GCT
GAAGTTTGCCTAGGTCGAAAGATCGATCTGGATGTGGACATTGAACAGAGGCAGAAGCCGGTCAGAG
AA
GCGAGCGTGAGTGCAGCTTCTGGCTCGCACTATGAGCAAGCGGTAACCAGCTCAGAGAGCGCGTACTC
C
TCTAACACCGGCTTCCCCGCCCCCAAACCTCTGCACGAAGTGCACACAGAGAAAGTCACACAGGAAATC
GTC
ACTGAGAGCTCTGTATCTTCCAGGCAGAGTCAGAAGGTAGTACCGCCACCTGATCCTGTGGCTTCTG
GT
AATATTATAGTGACGGAAACTTCCTATGCCAAAGGCTCAGCAGTGCCACCCAGCACTGTGCTCCTGGC
T
CCCAGACAGCCACAGAGCCTGATCGTGACAGAGAGGGTGTATGCTCCAACCTCCACCTTGGTGGATCAG
CAT
TATGCCAATGAAGAAAAAGTCCTTGTTACCGAACGAGTGATCCAGCCTAATGGGGGCATCCCTAAGC
CC
CTTGAGGTCACCCAGCATCTGAAAGATGCACAGTATGTAATGGTGAGGGAAAGAGAGAGCATCCTTGC
T
CCCAGCTCAGGCGTGCAGCCCACTCTGGCAATGCCCAGCGTGGCAGCAGGAGGACAGAATGTCACCGTG
ACA
GAAAGAATACTAACTCCTGCTTCCACTCTGCAGTCCAGCTACCAGATTCCCAGTGAAACCTCCATCA
CG
GCTAGGAACACTGTGCTCTCTAGTGTGGGAAGCATAGGTCCTCTGCCCAATTTAGATCTAGAGGAATC
T
GATCGTCCCAATTCTACTATAACCACATCTTCCACCAGGGTCACCAAGCATAGCACCATGCAACATTCT
TAC
TCCTAA


Translation (1122 aa):
MARSPGDRCALLLLVQLLAVVCLDFGNGLHLEVFSPRNEGKPFPKHTHLVRQKRAWITAPVALREGEDLS
R
KNPIAK
IHSDLAEEKGIKITYKYTGKGITEPPFGIFVFDRNTGELNITSILDREETPYFLLTGYALDSR
G
NNLEKPLELRIKVLDINDNEPVFTQEVFVGSIEELSAA
HTLVMKITATDADDPETLNAKVSYRIVSQEP
A
NSHMFYLNKDTGEIYTTSFTLDRE
EHSSYSLTVEARDGNGQITDKPVQQAQVQIRILDVNDNIPVVENK
M
YEGTVEENQVNVEVMRIKVTDADEVGSDNWLANFTFASGNEGGYFHIETDTQTNEGIVTLVKEVDYEEM
K
KLDLSIIVTNKAAFHKSILSKYKATPIPITVKVKNVVEGIHFKSSVVSFRASEAMDRSSLSRSIGNFQV
F
DEDTGQAAKV
TYVKVQDTDNWVSVDSVTSEIKLVKIPDFESRYVQNGTYTAKVVAISKEHPQKTITGTI
V
ITVEDVNDNCPVLVDSVRSVCEDEPYVNVTAEDLDGAQNSAPFSFSIIDQPPGTAQKWKITHQE
STSVL
L
QQSERKRGRSEIPFLISDSQGFSCPERQVLQLTVCECLKGGGCVAAQYDNYVGLGPAAIALMILALLLL
L
LVPLLLLICHCGGGAKGFTPIPGTIEMLHPWNNEGAPPEDKVVPSLLVADHAESSAVRGGVGGAMLKEG
M
MKGSSSASVTKGQHELSEVDGRWEEHRSLLTAGATHHVRTAGTIAANEAVRTRATGSSRDMSGARGAVA
V
NEEFLRSYFTE
KAASYNGEDDLHMAKDCLLVYSQEDTASLRGSVGCCSFIEGELDDLFLDDLGLKFKTL
A
EVCLGRKIDLDVDIEQRQKPVREASVSAASGSHYEQAVTSSESAYSSNTGFPAPKPLHEVHTEKVTQEI
V
TESSVSSRQSQKVVPPPDPVASGNIIVTETSYAKGSAVPPSTVLLAPRQPQSLIVTERVYAPTSTLVDQ
H
YANEEKVLVTERVIQPNGGIPKPLEVTQHLKDAQYVMVRERESILAPSSGVQPTLAMPSVAAGGQNVTV
T
ERILTPASTLQSSYQIPSETSITARNTVLSSVGSIGPLPNLDLEESDRPNSTITTSSTRVTKHSTMQHS
Y
S




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser