NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18308.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18308.1 Public Mus musculus 4 Plin2 21 106 86 CCDS HistoryNCBI Gene:11520Re-query CCDS DB by CCDS ID:18308.1Re-query CCDS DB by GeneID:11520See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 18308.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000000466 ENSMUSP00000000466 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000000466Link to Ensembl Protein Viewer:ENSMUSP00000000466Re-query CCDS DB by Nucleotide ID:ENSMUST00000000466Re-query CCDS DB by Protein ID:ENSMUSP00000000466
Original member Current member EBI,WTSI OTTMUST00000017238 OTTMUSP00000007962 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000017238Link to Vega Protein Viewer:OTTMUSP00000007962Re-query CCDS DB by Nucleotide ID:OTTMUST00000017238Re-query CCDS DB by Protein ID:OTTMUSP00000007962
Original member Current member NCBI NM_007408.3 NP_031434.3 Accepted alive Link to Nucleotide Sequence:NM_007408.3Link to Protein Sequence:NP_031434.3Re-query CCDS DB by Nucleotide ID:NM_007408Re-query CCDS DB by Protein ID:NP_031434Link to BLink:NP_031434.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031434.3 425 P43883 425 100% 0 0

Chromosomal Locations for CCDS 18308.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 86657033 86657404 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 86658581 86658715 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 86660088 86660269 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 86661934 86662213 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 86664429 86664511 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 86668367 86668562 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 86668650 86668679 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1278 nt):
ATGGCAGCAGCAGTAGTGGATCCGCAACAGAGCGTGGTGATGAGAGTGGCCAACCTGCCCTTGGTGAGCT
CT
ACCTACGACCTTGTGTCCTCCGCTTATGTCAGTACAAAGGATCAGTACCCGTATTTGAGATCCGTGTG
T
GAGATGGCCGAGAAGGGCGTGAAGACCGTGACCTCTGCGGCCATGACAAGTGCCCTGCCCATCATCCAG
AAG
CTGGAGCCACAAATTGCGGTTGCCAATACCTATGCCTGCAAGGGGCTAGACAGGATGGAGGAAAGAC
TG
CCTATTCTGAACCAGCCAACGTCCGAGATTGTTGCCAGTGCCAGAGGTGCCGTAACTGGGGCGAAGGA
T
GTGGTGACGACTACCATGGCTGGAGCCAAGGATTCTGTAGCCAGCACAGTCTCAGGGGTGGTGGATAAG
ACC
AAAGGAGCAGTGACTGGCAGCGTGGAAAGGACCAAGTCTGTGGTCAATGGCAGCATCAATACAGTTT
TG
GGGATGGTGCAGTTCATGAACAGTGGAGTAGATAATGCCATCACCAAGTCGGAGCTGCTGGTAGACCA
G
TACTTCCCTCTCACTCAGGAGGAGCTGGAGATGGAAGCAAAAAAGGTGGAAGGATTTGATATGGTTCAG
AAG
CCGAGCAACTATGAACGGCTGGAGTCCCTGTCTACCAAGCTCTGCTCTCGGGCTTATCACCAGGCTC
TC
AGCAGGGTTAAAGAGGCCAAACAAAAGAGCCAGGAGACCATTTCTCAGCTCCACTCCACTGTCCACCT
G
ATTGAATTCGCCAGGAAGAATATGCACAGTGCCAACCAGAAAATTCAGGGTGCTCAGGATAAGCTCTAT
GTC
TCGTGGGTGGAGTGGAAGAGAAGCATCGGCTACGACGACACCGATGAGTCCCACTGTGTTGAGCACA
TC
GAGTCACGTACTCTGGCTATCGCCCGCAACCTGACCCAGCAGCTCCAGACTACATGCCAGACTGTCCT
G
GTCAACGCCCAAGGGTTACCACAGAACATTCAAGATCAGGCCAAACACTTGGGGGTGATGGCAGGCGAC
ATC
TACTCCGTATTCCGCAATGCTGCCTCCTTTAAGGAAGTGTCCGATGGCGTCCTCACATCTAGCAAGG
GG
CAGCTGCAGAAAATGAAGGAATCCTTAGATGAAGTTATGGATTACTTTGTTAACAACACGCCTCTCAA
C
TGGCTGGTAGGTCCCTTTTATCCTCAGTCTACCGAGGTGAACAAGGCCAGCCTGAAGGTCCAGCAGTCT
GAG
GTCAAAGCTCAGTAA


Translation (425 aa):
MAAAVVDPQQSVVMRVANLPLVSSTYDLVSSAYVSTKDQYPYLRSVCEMAEKGVKTVTSAAMTSALPIIQ
K
LEPQ
IAVANTYACKGLDRMEERLPILNQPTSEIVASARGAVTGAKDVVTTTMAGAKDSVASTVSGVVDK
T
KGAVTGSVERTKSVVNGSINTVLGMVQFMNSGVDNAITKSELLVDQYFPLTQEEL
EMEAKKVEGFDMVQ
K
PSNYERLESLSTKLCSRAYHQALSRVKEAKQKSQETISQLHSTVHL
IEFARKNMHSANQKIQGAQDKLY
V
SWVEWKRSIGYDDTDESHCVE
HIESRTLAIARNLTQQLQTTCQTVLVNAQGLPQNIQDQAKHLGVMAGD
I
YSVFRNAASFKEVSDGVLTSSKGQLQKMKESLDEVMDYFVNNTPLNWLVGPFYPQSTEVNKASLKVQQS
E
VKAQ




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser