NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS51937.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
51937.1 Public Mus musculus 6 Gpr19 21 106 86 CCDS HistoryNCBI Gene:14760Re-query CCDS DB by CCDS ID:51937.1Re-query CCDS DB by GeneID:14760See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)


Attributes
CDS uses downstream AUG

Sequence IDs included in CCDS 51937.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000046255 ENSMUSP00000047630 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000046255Link to Ensembl Protein Viewer:ENSMUSP00000047630Re-query CCDS DB by Nucleotide ID:ENSMUST00000046255Re-query CCDS DB by Protein ID:ENSMUSP00000047630
Original member Current member EBI,WTSI ENSMUST00000066107 ENSMUSP00000066287 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000066107Link to Ensembl Protein Viewer:ENSMUSP00000066287Re-query CCDS DB by Nucleotide ID:ENSMUST00000066107Re-query CCDS DB by Protein ID:ENSMUSP00000066287
Original member Current member EBI,WTSI OTTMUST00000059660 OTTMUSP00000029039 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059660Link to Vega Protein Viewer:OTTMUSP00000029039Re-query CCDS DB by Nucleotide ID:OTTMUST00000059660Re-query CCDS DB by Protein ID:OTTMUSP00000029039
Original member Current member EBI,WTSI OTTMUST00000059663 OTTMUSP00000029040 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059663Link to Vega Protein Viewer:OTTMUSP00000029040Re-query CCDS DB by Nucleotide ID:OTTMUST00000059663Re-query CCDS DB by Protein ID:OTTMUSP00000029040
Original member Current member NCBI NM_001167694.2 NP_001161166.1 Accepted alive Link to Nucleotide Sequence:NM_001167694.2Link to Protein Sequence:NP_001161166.1Re-query CCDS DB by Nucleotide ID:NM_001167694Re-query CCDS DB by Protein ID:NP_001161166Link to BLink:NP_001161166.1
Original member Current member NCBI NM_001167697.2 NP_001161169.1 Accepted alive Link to Nucleotide Sequence:NM_001167697.2Link to Protein Sequence:NP_001161169.1Re-query CCDS DB by Nucleotide ID:NM_001167697Re-query CCDS DB by Protein ID:NP_001161169Link to BLink:NP_001161169.1
Original member Current member NCBI NM_001167699.2 NP_001161171.1 Accepted alive Link to Nucleotide Sequence:NM_001167699.2Link to Protein Sequence:NP_001161171.1Re-query CCDS DB by Nucleotide ID:NM_001167699Re-query CCDS DB by Protein ID:NP_001161171Link to BLink:NP_001161171.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001161166.1 415 Q61121-1 415 100% 0 0
NP_001161169.1 415 Q61121-1 415 100% 0 0
NP_001161171.1 415 Q61121-1 415 100% 0 0

Chromosomal Locations for CCDS 51937.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 134869213 134870460 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1248 nt):
ATGGTTTTTGCTCACAGAATGGATAACGACCAGCCGCCTGTGGTGACTGCCACCCTGCTGGTGCCCCTTC
AG
AACAGCAGCTGCGCGGAAGCAGCTGAGGCCCTGCTGCCCCATGGCCTGATGGGATTGCATGAGGAGCA
C
AGCTGGATGAGCAACAGGACAGAGCTTCAGTACGAGCTGAACCCTGGAGAGGTGGCCACCGCCAGCATC
TTC
TTTGGCGCTTTGTGGTTGTTCTCCATCTTTGGCAATTCCCTGGTATGTCTGGTCATCCACCGGAGCC
GG
AGGACTCAGTCCACCACCAACTACTTCGTGGTGTCCATGGCGTGTGCTGACCTTCTCATCAGCGTGGC
C
AGCACGCCGTTTGTCGTGCTGCAGTTCACCACCGGGAGGTGGACCCTGGGTAGCGCCATGTGCAAGGTG
GTC
CGCTACTTCCAGTACCTCACCCCCGGCGTGCAGATCTACGTGCTGCTCTCCATCTGCATCGACCGCT
TC
TATACCATCGTCTACCCGCTGAGCTTCAAGGTGTCCCGAGAGAAGGCCAAGAAAATGATTGCAGCCTC
C
TGGATCTTGGACGCGGCCTTCGTGACGCCTGTCTTCTTTTTCTACGGCTCTAACTGGGATAGTCACTGT
AAC
TACTTCCTCCCTCCCTCCTGGGAGGGAACTGCCTATACCGTCATCCACTTCTTGGTGGGCTTCGTGA
TT
CCCTCCATCCTCATAATCCTGTTTTACCAGAAGGTCATAAAGTATATCTGGAGAATAGGCACGGACGG
G
CGGACGCTGAGAAGGACGATGAACATTGTCCCCAGGACAAAGGTGAAAACGGTCAAGATGTTCCTGCTC
TTG
AACCTAGTGTTCCTGTTCTCCTGGCTACCTTTCCATGTGGCTCAGCTCTGGCATCCCCATGAGCAAG
AC
TACAAGAAGAGCTCCCTTGTCTTCACGGCAGTCACGTGGGTATCTTTCAGCTCTTCAGCCTCGAAACC
C
ACTCTGTACTCTATTTATAATGCCAATTTTCGGAGAGGGATGAAAGAGACATTCTGCATGTCCTCGATG
AAA
TGCTACCGCAGCAATGCCTACACCATCACGACCAGCTCACGGATGGCCAAAAGAAACTATGTGGGCA
TT
TCGGAAATCCCTCCCGTGAGCAGGACCATAACCAAAGACTCCATCTATGACTCATTTGACCGGGAGGC
C
AGGGAGAAGAAGCTCGCCTGGCCCATCAACTCAAACCCTCCAAACACTTTTGTCTGA


Translation (415 aa):
MVFAHRMDNDQPPVVTATLLVPLQNSSCAEAAEALLPHGLMGLHEEHSWMSNRTELQYELNPGEVATASI
F
FGALWLFSIFGNSLVCLVIHRSRRTQSTTNYFVVSMACADLLISVASTPFVVLQFTTGRWTLGSAMCKV
V
RYFQYLTPGVQIYVLLSICIDRFYTIVYPLSFKVSREKAKKMIAASWILDAAFVTPVFFFYGSNWDSHC
N
YFLPPSWEGTAYTVIHFLVGFVIPSILIILFYQKVIKYIWRIGTDGRTLRRTMNIVPRTKVKTVKMFLL
L
NLVFLFSWLPFHVAQLWHPHEQDYKKSSLVFTAVTWVSFSSSASKPTLYSIYNANFRRGMKETFCMSSM
K
CYRSNAYTITTSSRMAKRNYVGISEIPPVSRTITKDSIYDSFDREAREKKLAWPINSNPPNTFV




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser