NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS37511.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
37511.1 Public Mus musculus 17 Rgs11 21 106 86 CCDS HistoryNCBI Gene:50782Re-query CCDS DB by CCDS ID:37511.1Re-query CCDS DB by GeneID:50782See the combined annotation on chromosome 17 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 37511.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000025020 ENSMUSP00000025020 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000025020Link to Ensembl Protein Viewer:ENSMUSP00000025020Re-query CCDS DB by Nucleotide ID:ENSMUST00000025020Re-query CCDS DB by Protein ID:ENSMUSP00000025020
Original member NCBI NM_001081069.1 NP_001074538.1 Updated not alive Link to Nucleotide Sequence:NM_001081069.1Link to Protein Sequence:NP_001074538.1Re-query CCDS DB by Nucleotide ID:NM_001081069Re-query CCDS DB by Protein ID:NP_001074538
Current member NCBI NM_001081069.2 NP_001074538.1 Accepted alive Link to Nucleotide Sequence:NM_001081069.2Link to Protein Sequence:NP_001074538.1Re-query CCDS DB by Nucleotide ID:NM_001081069Re-query CCDS DB by Protein ID:NP_001074538Link to BLAST:NP_001074538.1

Chromosomal Locations for CCDS 37511.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 17 (NC_000083.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17See the combined annotation on chromosome 17 in Sequence Viewer

Chromosome Start Stop Links
17 26202973 26203041 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26203296 26203392 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26203462 26203512 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26203578 26203684 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26204332 26204383 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26204487 26204545 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26204851 26204927 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26205108 26205189 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26205707 26205775 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26207299 26207322 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26207396 26207457 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26207546 26207659 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26207759 26207874 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26207992 26208079 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26208164 26208302 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26210457 26210539 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17
17 26210619 26210730 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 17Link to Ensembl Genome Browser on chromosome 17

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1401 nt):
ATGGCCATGGTTACCCGCTGCACACCCCACGGCGGGTGCTCCCGAATGCAGAGACCGCATCTCAGCAAGA
TG
GAGCGGGTAGTCGTGAGTATGCAGGACCCTGACCAAGGCGTGAAGATGCGGAGCCAGCGCCTTCTGAT
C
ACTGTCATTCCCCACGCGGTAGCGGGCAGAGACCTCGTGGAATGGCTGGTTCAGAAGTTCTGCATCTTG
GAG
GATGAAGCCCTGCACCTGGGCACACTCCTGGCGCAGCACGGCTACATCTACCCACTGCGTGAGTCCC
GA
GACCTGACACTCAGGCCGGACGAGACCCCCTACAGGTTCCAGACACCCTACTTTTGGACAAGCACTAT
G
TGGCCAGCTGCTGAGCTAGACTATGCCATCTATCTGGCTAAGAAGAACATCCAAAAACAAGGGGCTTTA
GTG
GACTATGAGAAGGAACATTATGCCCTGCTGCACAAGAAGATCAACCATGCATGGGATCTGGTATTGA
TG
CAGGCTCGAGAGCAGCTGCGGGCTGCTAAGCAGCGGCGGAAGGGAGACAGAATGGTCATTTCGTGTCA
G
GAGCAGACATACTGGCTGGTGAATAAGCCCCCTCCTGGGGCACCTAACATTTTGGAGCAGGGTCCTGAG
AGG
GGCTCTTACAACCCCAGTCACATGCAGATGAGCTCGGATTTCTATAAGTGTGAGATCGAGTGCTTCA
GG
AAGGCACTGGGCAGGAACCGGGTGAAGTCCTCTGCCTGCCTCGAGGCGTACCTGAAGTTCAGCAGCCA
G
CACGGGCCGCATGATCCCATCATGTCAGGGTGTCTGCCCAGCAACCCCTGGATCACAGATGATGTCACC
TAC
TGGGCCATGAATGCGCCCAACGTGGCTGCCCCCACAAAACTCCGCGTTGAGCGATGGAGCTTCAGCT
TC
CGGGAGCTGCTGGATGACCCCGTGGGGCGTGCCCACTTCATGGACTTTCTCCAGAAGGAATTCAGTGC
G
GAAAACCTCAGCTTCTGGGAGGCATGTGAGGAGCTGCGCTTTGGCGGACAGGCCCAGGTCCCCACCTTG
GTG
GACTCTGTGTATCAGCAGTTCCTGGCCCCTGGAGCTGCCCGCTGGATCAACATTGACAGCAGGACGA
TG
GAGCGGACCCTGGAGGGTCTGCGCCAGCCACACCGCTATGTCCTGGATGCAGCACAGCTTCACATCTA
C
ATGCTCATGAAGAAGGACTCCTATCCAAGGTTCCTGAAGTCTGACATATACAAGGGCCTGCTGGAGGAA
GCT
GTGATTCCACTGGAGACAAAGCGCTGGCCATTTCCATTCTTGCGGAAGCCTCTGCACTCAAGCCCCA
GC
CCTGCTCTCCAGTCTACCCCCAGGGAGCCTGCAGCAACCAGTTCCCCTGAAGGTGCCGATGGGGAGTA
G


Translation (466 aa):
MAMVTRCTPHGGCSRMQRPHLSKMERVVVSMQDPDQGVKMRSQRLLITVIPHAVAGRDLVEWLVQKFCIL
E
D
EALHLGTLLAQHGYIYPLRESRDLTLRPDETPYRFQTPYFWTSTMWPAAELDYAIYLAKKNIQKQGAL
V
DYEK
EHYALLHKKINHAWDLVLMQAREQLRAAKQRRKGDRMVISCQEQTYWLVNKPPPGAPNILEQGPE
R
GSYNPSHMQM
SSDFYKCEIECFRKALGRNRVKSSACLEAYLKFSSQHGPHDPIMSGCLPSNPWITDDVT
Y
WAMNAP
NVAAPTKLRVERWSFSFRELLDDPVGRAHFMDFLQKEFSAENLSFWEACEELRFGGQAQVPTL
V
DSVY
QQFLAPGAARWINIDSRTMERTLEGLRQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYKGLLEE
A
VIPLETKR
WPFPFLRKPLHSSPSPALQSTPREPAATSSPEGADGE



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser