NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS57464.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
57464.1 Public Mus musculus 6 Slco1a5 21 106 86 CCDS HistoryNCBI Gene:108096Re-query CCDS DB by CCDS ID:57464.1Re-query CCDS DB by GeneID:108096See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 10, NCBI annotation release 38.1, Ensembl annotation release 68

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 57464.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000081380 ENSMUSP00000080116 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000081380Link to Ensembl Protein Viewer:ENSMUSP00000080116Re-query CCDS DB by Nucleotide ID:ENSMUST00000081380Re-query CCDS DB by Protein ID:ENSMUSP00000080116
Original member Current member EBI,WTSI ENSMUST00000111825 ENSMUSP00000137607 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000111825Link to Ensembl Protein Viewer:ENSMUSP00000137607Re-query CCDS DB by Nucleotide ID:ENSMUST00000111825Re-query CCDS DB by Protein ID:ENSMUSP00000137607
Original member Current member EBI,WTSI OTTMUST00000059262 OTTMUSP00000062819 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059262Link to Vega Protein Viewer:OTTMUSP00000062819Re-query CCDS DB by Nucleotide ID:OTTMUST00000059262Re-query CCDS DB by Protein ID:OTTMUSP00000062819
Original member Current member EBI,WTSI OTTMUST00000059261 OTTMUSP00000062820 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000059261Link to Vega Protein Viewer:OTTMUSP00000062820Re-query CCDS DB by Nucleotide ID:OTTMUST00000059261Re-query CCDS DB by Protein ID:OTTMUSP00000062820
Original member Current member NCBI NM_001267707.1 NP_001254636.1 Accepted alive Link to Nucleotide Sequence:NM_001267707.1Link to Protein Sequence:NP_001254636.1Re-query CCDS DB by Nucleotide ID:NM_001267707Re-query CCDS DB by Protein ID:NP_001254636Link to BLAST:NP_001254636.1
Original member Current member NCBI NM_130861.3 NP_570931.1 Accepted alive Link to Nucleotide Sequence:NM_130861.3Link to Protein Sequence:NP_570931.1Re-query CCDS DB by Nucleotide ID:NM_130861Re-query CCDS DB by Protein ID:NP_570931Link to BLAST:NP_570931.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001254636.1 670 Q91YY5 670 99.403% 0 4
NP_570931.1 670 Q91YY5 670 99.403% 0 4

Chromosomal Locations for CCDS 57464.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 6 (NC_000072.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 142234662 142234881 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142236204 142236321 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142237522 142237586 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142242002 142242174 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142243822 142243987 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142248645 142248840 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142250201 142250365 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142253028 142253249 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142254369 142254467 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142258978 142259124 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142262622 142262728 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142266298 142266430 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142268192 142268333 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 142275459 142275518 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2013 nt):
ATGGGAGAAACAGAGAAAAGGATTGCAACCCATGGGGTCAGATGCTTTTCTAAGATCAAGATGTTTCTGT
TG
GCATTAACATGTGCATATGTATCCAAATCACTCTCAGGAATTTATATGAATTCCATGCTTACACAAAT
A
GAGAGACAATTCGATATCCCCACATCTATAGTTGGACTTATCAATGGGAGCTTTGAGATTGGAAATCTT
TTG
TTGATTATACTCGTGAGTTACTTTGGAACAAAATTGCACAGACCTATCATGATTGGTATTGGATGTG
TG
ATTATGGGCCTAGGGTGTTTCTTAATGTCCTTACCTCATTTCCTCATGGGCCGATACGAATATGAAAC
A
ACGATTTCACCTACAAGCAACTTGTCCTCAAACAGCTTCTTGTGTATGGAAAACAGAACACAGACCTTA
AAG
CCAACGCAAGACCCTGCAGAGTGTGTGAAAGAAATGAAATCATTAATGTGGATATATGTACTGGTAG
GA
AACATCATACGTGGAATTGGTGAAACTCCCATCATGCCCTTGGGTATTTCCTACATAGAAGATTTTGC
C
AAATCTGAAAACTCTCCTTTATATATTGGGATTTTAGAATCAGGAAAGATGATTGGCCCAATTGTTGGA
CTT
TTGTTGGGATCCTTCTGTGCAAGAATTTATGTAGACACAGGGTCTGTGAATACAGATGACCTGACCA
TA
ACTCCCACTGATACACGCTGGGTCGGTGCTTGGTGGATTGGCTTTTTGGTCTGTGCAGGAGTGAATAT
C
CTGACCAGCATCCCCTTTTTCTTCTTTCCAAAAACACTCCCAAAGGAAGGATTACAGGATAATGTGGAT
AGA
ACTGAAAATGACAAAGAGGAGAAGCACAGAGAAAAAGCCAAGGAGGAAAACCGAGGAATCACTAAAG
AT
TTCCTGCCATTCATGAAGAGCCTCTCCTGCAATCCTATTTACATGCTTCTCATCCTGACAAGTGTGCT
C
CAGATAAACGCATTTATCAATATGTTTACCTTCTTGCCCAAATACCTGGAGCAGCAGTATGGAAAATCC
ACT
TCAGAGGTCGTCCTCCTCATAGGTGTTTGTAACTTACCTCCAATCTGCATTGGATATTTACTTATTG
GC
TTTATTATGAAGAAGTTCAGGATTACTGTCAAGAAGGCTGCATACATGGCATTCTGCCTATCCCTGTT
T
GAGTACCTTCTGTCTTACTTTCACTTTATGATAAGCTGTGATAATTTCCAAGTTGCTGGCTTAACTACC
TCT
TATGAAGGAGTTCAGCACCCTCTATATGTGGAGAACAAGGTCCTTGCTGACTGCAACACAAGGTGTA
GC
TGCTTAACAAACACATGGGATCCAGTGTGTGGAGACAATGGCCTATCATACATGTCAGCCTGCCTCGC
G
GGCTGTGAGAAGTCTGTTGGAATGGGAACCCACATGGTGTTTCAAAATTGCAGCTGCATTCAGTCATCA
GGA
AACTCATCTGCAGTCCTGGGGCTGTGTAAAAAAGGCCCTGAGTGTGCTAACAAGCTGCAGTACTTTT
TA
ATCATGTCGGTAATTGGCAGTTTCATCTATTCGATCACAGCCATACCTGGGTACATGGTTCTTCTGAG
G
TGTATCAAGTCTGAAGAGAAGTCCCTTGGAATTGGATTACACGCATTTTGCACAAGAATATTCGCTGGC
ATC
CCTGCACCCATTTACTTTGGAGCTTTGATAGACAGAACCTGCTTACATTGGGGAACTCTGAAATGTG
GT
GAGCCAGGAGCCTGTAGGATGTACAATATAAATAACTTCAGGCGCATTTATCTAGTGTTGCCTGCAGC
A
CTAAGAGGATCAAGCTATCTCCCTGCATTCTTCATTCTGATACTTATGAGGAAATTCCAGCTCCCTGGG
GAA
ATGTACTCTTCTGAAACTGAACTTGCAGACATGAAGCTCACAGTGAAGAAAAGCGAGTGCACAGATG
TG
CACAGAATTCCTAAGGTCGAGAATGATGGAGAACTGAAAACTAAGCTGTAA


Translation (670 aa):
MGETEKRIATHGVRCFSKIKMFLLALTCAYVSKSLSGIYMNSMLTQIERQFDIPTSIVGLINGSFEIGNL
L
LIILVSYFGTKLHRPIMIGIGCVIMGLGCFLMSLPHFLMG
RYEYETTISPTSNLSSNSFLCMENRTQTL
K
PTQDPA
ECVKEMKSLMWIYVLVGNIIRGIGETPIMPLGISYIEDFAKSENSPLYIGILESGKMIGPIVG
L
LLGSFCARIYVDTGSVNT
DDLTITPTDTRWVGAWWIGFLVCAGVNILTSIPFFFFPKTLPKEGLQDNVD
R
TENDKEEKHREKAKEENRGITK
DFLPFMKSLSCNPIYMLLILTSVLQINAFINMFTFLPKYLEQQYGKS
T
SEVVLLI
GVCNLPPICIGYLLIGFIMKKFRITVKKAAYMAFCLSLFEYLLSYFHFMISCDNFQVAGLTT
S
YE
GVQHPLYVENKVLADCNTRCSCLTNTWDPVCGDNGLSYMSACLAGCEKSVGMGTHMVFQNCSCIQSS
G
NSSAVLGLCKKGPECANKLQYFLIMSVIGSFIYSITAIPGYMVLL
RCIKSEEKSLGIGLHAFCTRIFAG
I
PAPIYFGALIDRTCLHWGTLKCGEPGACRMYNINNF
RRIYLVLPAALRGSSYLPAFFILILMRKFQLPG
E
MYSSETELADMKLTVKKSECTDVHRIPKVENDGELKTKL




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser