NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29127.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29127.1 Public Mus musculus 18 Pkd2l2 21 106 86 CCDS HistoryNCBI Gene:53871Re-query CCDS DB by CCDS ID:29127.1Re-query CCDS DB by GeneID:53871See the combined annotation on chromosome 18 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 29127.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000014647 ENSMUSP00000014647 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000014647Link to Ensembl Protein Viewer:ENSMUSP00000014647Re-query CCDS DB by Nucleotide ID:ENSMUST00000014647Re-query CCDS DB by Protein ID:ENSMUSP00000014647
Original member Current member EBI,WTSI ENSMUST00000166156 ENSMUSP00000127257 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000166156Link to Ensembl Protein Viewer:ENSMUSP00000127257Re-query CCDS DB by Nucleotide ID:ENSMUST00000166156Re-query CCDS DB by Protein ID:ENSMUSP00000127257
Original member Current member NCBI NM_001163004.1 NP_001156476.1 Accepted alive Link to Nucleotide Sequence:NM_001163004.1Link to Protein Sequence:NP_001156476.1Re-query CCDS DB by Nucleotide ID:NM_001163004Re-query CCDS DB by Protein ID:NP_001156476Link to BLAST:NP_001156476.1
Original member Current member NCBI NM_016927.3 NP_058623.2 Accepted alive Link to Nucleotide Sequence:NM_016927.3Link to Protein Sequence:NP_058623.2Re-query CCDS DB by Nucleotide ID:NM_016927Re-query CCDS DB by Protein ID:NP_058623Link to BLAST:NP_058623.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001156476.1 621 Q9JLG4 621 100% 0 0
NP_058623.2 621 Q9JLG4 621 100% 0 0

Chromosomal Locations for CCDS 29127.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 18 (NC_000084.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18See the combined annotation on chromosome 18 in Sequence Viewer

Chromosome Start Stop Links
18 34409467 34409497 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34409810 34409911 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34412681 34412814 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34414463 34414719 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34416828 34417049 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34425016 34425244 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34427317 34427487 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34428087 34428268 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34430226 34430346 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34430683 34430784 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34433289 34433353 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34435316 34435367 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34438102 34438214 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18
18 34438731 34438815 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 18Link to Ensembl Genome Browser on chromosome 18

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1866 nt):
ATGTCTGAGGCGACTTGGTGGTACCGAGGAGGGACTTCAAAACATGACCTGCATTACAGAAGGGAAGCGG
AG
GTTAACACCACACTCGAGGAGTTGTTACTCTATTTTATTTTCTTAATAAATCTATGCATATTGACTTT
T
GGGATGGTCAATCCACATATGTACTATTTAAACAAAGTTATGTCGTCTCTGTTTGTGGACACTTCTCTA
CCT
GATGATGAAAGAAGCAGCTTTAGGTCCATTCGGAGCATAACTGAGTTTTGGAAGTTCATGGAAGGAC
CC
CTCATCGACGGCTTGTACTGGGACTCGTGGTATGGCAACAAACAGCTGTACAGTGTGAAGAACAGCAG
C
CGCATCTACTACGAGAACGTTCTTCTCGGCATCCCCAGAGTGCGGCAACTGCGAGTCCGAAACAACACT
TGC
AAGGTCTACCCAGCTTTCCAGTCCCTGGTCAGCGACTGCTACAGCAAGTACACAGTGGAAAACGAAG
AC
TTCTCTGATTTTGGCCTCAAACGCAATCCAGAATGGACGCACACACCTTCTTCCCGCACTGCCCCATG
G
CACTGGGGGTTTGTTGGCGTATACCGAGATGGAGGATATATAGTCACGTTATCAAAATCAAAATCTGAA
ACC
AAAGCCAAATTTGTTGACCTTCGACTGAACAACTGGATTAGCAGAGGCACCAGGGCTGTTTTTATTG
AT
TTCTCCCTGTACAATGCTAATGTCAACCTGTTTTGCATCATCAGGCTGCTGGCAGAGTTCCCTGCGAC
G
GGTGGGCTCCTCACCTCCTGGCAGTTCTACTCTGTGAAGCTCCTCAGATACGTCTCCTACTACGACTAC
TTC
ATTGCCTCCTGTGAAGTCATATTTTGTATTTTTCTCTTTGTCTTCATAATACAAGAACTGAGGAAAG
TG
AACGAGTTTAAGTCTGCCTATTTCAGAAGTGTCTGGAACTGGCTGGAGATGCTGCTCCTGCTGCTCTG
T
TTTCTCGCCGTGTCTTTCTATGCATACTGTAACATGCAGAGCTTTCTCTTGCTTGGACAGCTGCTGAAA
AAC
ACTGACAGCTATCCCGACTTTTACTTCCTTGCATACTGGCACATTTACTATAACAACGTAATTGCTA
TC
ACTATCTTCTTTGCATGGATAAAGATATTCAAGTTCATAAGCTTCAATGAGACAATGTCGCAGCTGTC
A
TCAACACTCTCCCGCTGCATGAAGGACATCGTGGGGTTCGCCATCATGTTCTTCATCATCTTCTCTGCT
TAT
GCCCAGTTGGGATTTCTGGTTTTTGGGTCACAGGTTGATGATTTTTCAACTTTTCAAAATTCCATAT
TT
GCACAATTTCGAATTGTCCTCGGGGACTTTAATTTTGCTGGCATCCAGCAGGCCAACTGGATCTTGGG
G
CCCATCTACTTCATCACGTTCATCTTCTTCGTGTTCTTTGTGCTCCTGAACATGTTCTTGGCAATAATT
AAT
GACACCTATTCTGAAGTTAAGGCTGATTATTCAATAGGCAGAAGACCAGATTTTGAACTTGGTAAAA
TA
ATTCAAAAGAGTTGCTTTAATGTTCTCGAGAAACTCAGACTCAAGAAAGCTCAAGCTAAAGAAGAAAA
G
AAAATGCAAACCACTGACTTGGCCCAGAGAGCCAGAAGAGACGGCTTTGATGAAAGTGAGATCCAAGAG
GCA
GAGCAGATGAAAAGATGGAAGGAAAGGCTTGAAAAAAAGTATTATTCTACAGAAATTCAAGACGATT
AT
CAGCCTGTCACTCAGCAAGAATTCCGAGAGCTCTTTTTATACGCGGTGGAGCTTGAGAAGGAATTACA
C
TATGTCAGTTTAAAACTGAACCAACTGATGAGAAAGCTGCACTAG


Translation (621 aa):
MSEATWWYRGGTSKHDLHYRREAEVNTTLEELLLYFIFLINLCILTFGMVNPHMYYLNKVMSSLFVDTSL
P
DDERSSFRSIRSITEFWK
FMEGPLIDGLYWDSWYGNKQLYSVKNSSRIYYENVLLGIPRVRQLRVRNNT
C
KVYPAFQSLVSDCYSKYTVENEDFSDFGLKRNP
EWTHTPSSRTAPWHWGFVGVYRDGGYIVTLSKSKSE
T
KAKFVDLRLNNWISRGTRAVFIDFSLYNANVNLFCII
RLLAEFPATGGLLTSWQFYSVKLLRYVSYYDY
F
IASCEVIFCIFLFVFIIQELRKVNEFKSAYFRSVWNWLEMLLLL
LCFLAVSFYAYCNMQSFLLLGQLLK
N
TDSYPDFYFLAYWHIYYNNVIAITIFFAWIK
IFKFISFNETMSQLSSTLSRCMKDIVGFAIMFFIIFSA
Y
AQLGFLVFGSQVDDFSTFQNS
IFAQFRIVLGDFNFAGIQQANWILGPIYFITFIFFVFFVLLNMFLAII
N
DTYSEVKADYSIGRRPDFELGKIIQK
SCFNVLEKLRLKKAQAKEEKKMQTTDLAQRARRDGFDESEIQE
A
EQMKRWKERLEKKYYSTEIQDDYQPVTQQEFR
ELFLYAVELEKELHYVSLKLNQLMRKLH



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser