NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS41023.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
41023.1 Public Mus musculus X Ikbkg 21 106 86 CCDS HistoryNCBI Gene:16151Re-query CCDS DB by CCDS ID:41023.1Re-query CCDS DB by GeneID:16151See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 41023.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000114127 ENSMUSP00000109762 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114127Link to Ensembl Protein Viewer:ENSMUSP00000109762Re-query CCDS DB by Nucleotide ID:ENSMUST00000114127Re-query CCDS DB by Protein ID:ENSMUSP00000109762
Original member Current member EBI,WTSI ENSMUST00000114128 ENSMUSP00000109763 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114128Link to Ensembl Protein Viewer:ENSMUSP00000109763Re-query CCDS DB by Nucleotide ID:ENSMUST00000114128Re-query CCDS DB by Protein ID:ENSMUSP00000109763
Original member Current member EBI,WTSI ENSMUST00000114133 ENSMUSP00000109768 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000114133Link to Ensembl Protein Viewer:ENSMUSP00000109768Re-query CCDS DB by Nucleotide ID:ENSMUST00000114133Re-query CCDS DB by Protein ID:ENSMUSP00000109768
Original member Current member EBI,WTSI ENSMUST00000164101 ENSMUSP00000126770 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000164101Link to Ensembl Protein Viewer:ENSMUSP00000126770Re-query CCDS DB by Nucleotide ID:ENSMUST00000164101Re-query CCDS DB by Protein ID:ENSMUSP00000126770
Original member Current member EBI,WTSI OTTMUST00000042945 OTTMUSP00000019310 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000042945Link to Vega Protein Viewer:OTTMUSP00000019310Re-query CCDS DB by Nucleotide ID:OTTMUST00000042945Re-query CCDS DB by Protein ID:OTTMUSP00000019310
Original member Current member EBI,WTSI OTTMUST00000047322 OTTMUSP00000021358 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000047322Link to Vega Protein Viewer:OTTMUSP00000021358Re-query CCDS DB by Nucleotide ID:OTTMUST00000047322Re-query CCDS DB by Protein ID:OTTMUSP00000021358
Original member Current member EBI,WTSI OTTMUST00000047324 OTTMUSP00000021360 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000047324Link to Vega Protein Viewer:OTTMUSP00000021360Re-query CCDS DB by Nucleotide ID:OTTMUST00000047324Re-query CCDS DB by Protein ID:OTTMUSP00000021360
Original member Current member NCBI NM_001161423.1 NP_001154895.1 Accepted alive Link to Nucleotide Sequence:NM_001161423.1Link to Protein Sequence:NP_001154895.1Re-query CCDS DB by Nucleotide ID:NM_001161423Re-query CCDS DB by Protein ID:NP_001154895Link to BLink:NP_001154895.1
Original member Current member NCBI NM_010547.2 NP_034677.2 Accepted alive Link to Nucleotide Sequence:NM_010547.2Link to Protein Sequence:NP_034677.2Re-query CCDS DB by Nucleotide ID:NM_010547Re-query CCDS DB by Protein ID:NP_034677Link to BLink:NP_034677.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_001154895.1 412 O88522 412 100% 0 0
NP_034677.2 412 O88522 412 100% 0 0

Chromosomal Locations for CCDS 41023.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 74432820 74433006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74433803 74434014 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74437164 74437282 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74438907 74439059 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74439875 74439950 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74443345 74443488 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74443772 74443914 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74447859 74447920 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 74448217 74448359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1239 nt):
ATGAACAAGCACCCCTGGAAGAACCAGCTGAGTGAGATGGTGCAGCCCAGTGGTGGCCCAGCAGAGGACC
AG
GACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCCTTCAGAGCAGGGTAC
T
CCTGAGACCCTCCAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAGACGCTATCCGGCAGAGCAATCAG
ATG
CTGAGGGAACGCTGTGAGGAGCTGCTGCATTTCCAGGTCAGCCAGCGGGAGGAGAAGGAGTTCCTTA
TG
TGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGACTGAGCTTGGAGAAGCTTGATCTTCGGAGTCA
G
AGGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAGCAGATGGCTGAGGACAAGGCC
TCT
GTGAAAGCTCAGGTGACATCATTGCTCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCA
CC
AAGGATCGGCAAGCTTTAGAGGGAAGGATTCGAGCAGTTAGTGAGCAGGTCAGACAGCTGGAGAGTGA
G
CGGGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGAGCGTGGAG
GCT
GCCTTGCGAATGGAGCGGCAGGCTGCTTCAGAGGAGAAGCGGAAGCTGGCTCAGTTGCAGGCAGCCT
AT
CACCAGCTCTTCCAAGACTACGACAGCCACATTAAGAGCAGCAAGGGCATGCAGCTGGAAGATCTGAG
G
CAACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGAATTGATTGATAAGCTGAAAGAGGAG
GCT
GAGCAGCACAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAGGCGGATATCTACAAGGCTG
AC
TTCCAAGCTGAGAGGCATGCCCGGGAGAAGCTGGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGA
G
CAGCTGCAGCGCGAGTTCAACAAGCTGAAAGTTGGCTGCCATGAGTCAGCCAGGATTGAGGATATGAGG
AAG
CGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAGCTCACCACTCCTTTCATTTGGCCT
TG
TCCAACCAGCGGAGGAGCCCTCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGC
T
CCTGATATGGACACTCTACAGATACATGTCATGGAGTGCATAGAGTAG


Translation (412 aa):
MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRDAIRQSNQ
M
LRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQ
QMAEDKA
S
VKAQVTSLLGELQESQSRLEAATKDRQALEG
RIRAVSEQVRQLESEREVLQQQHSVQVDQLRMQNQSVE
A
ALRMERQAASEE
KRKLAQLQAAYHQLFQDYDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEE
A
EQHKIVMETVPVLKAQ
ADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESARIEDMR
K
RHVETPQPPLLPAP
AHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser