NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS52428.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
52428.1 Public Mus musculus 7 Inpp5a 21 106 86 CCDS HistoryNCBI Gene:212111Re-query CCDS DB by CCDS ID:52428.1Re-query CCDS DB by GeneID:212111See the combined annotation on chromosome 7 in Sequence Viewer

Public since: CCDS release 7, NCBI annotation release 37.2, Ensembl annotation release 61

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 52428.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000106098 ENSMUSP00000101704 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000106098Link to Ensembl Protein Viewer:ENSMUSP00000101704Re-query CCDS DB by Nucleotide ID:ENSMUST00000106098Re-query CCDS DB by Protein ID:ENSMUSP00000101704
Original member Current member EBI,WTSI OTTMUST00000060126 OTTMUSP00000029319 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000060126Link to Vega Protein Viewer:OTTMUSP00000029319Re-query CCDS DB by Nucleotide ID:OTTMUST00000060126Re-query CCDS DB by Protein ID:OTTMUSP00000029319
Original member Current member NCBI NM_001127363.1 NP_001120835.1 Accepted alive Link to Nucleotide Sequence:NM_001127363.1Link to Protein Sequence:NP_001120835.1Re-query CCDS DB by Nucleotide ID:NM_001127363Re-query CCDS DB by Protein ID:NP_001120835Link to BLink:NP_001120835.1

Chromosomal Locations for CCDS 52428.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 7 (NC_000073.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 7Link to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7See the combined annotation on chromosome 7 in Sequence Viewer

Chromosome Start Stop Links
7 139389390 139389464 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139454054 139454095 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139477995 139478095 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139481632 139481719 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139511408 139511471 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139516631 139516734 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139523837 139523889 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139525662 139525781 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139538179 139538263 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139558874 139558969 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139559064 139559138 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139567364 139567437 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139574944 139575055 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139577350 139577418 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7
7 139578182 139578262 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 7Link to Ensembl Genome Browser on chromosome 7Link to Vega Genome Browser on chromosome 7

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1239 nt):
ATGGCGGGGAAGGCGGCCGCCCCCGGCACCGCGGTCCTGCTGGTCACGGCCAACGTGGGCTCGCTCTTCG
AC
GACCCAGAAAACCTGCAGAAGAACTGGCTTCGGGAATTTTACCAGGTCCTGCACACACACAAGCCTCA
C
TTCATGGCCTTGCACTGCCAAGAATTTGGAGGGAAAAACTACGAGGCCTCCATGTCCCATGTGGACAAA
TTT
GTCAAAGAACTACTATCCAGTGACGCAATGAAAGAATACAACAGGGCGCGTGTCTACCTGGATGAAA
AC
TACAAGTCACAGGAACACTTCACGGCACTAGGAAGCTTTTATTTTCTTCACGAATCCTTAAAAAACAT
C
TACCAGTTTGACTTTAAAGCTAAGAAGTATAAAAAAGTCACTGGCAAGGAGATCTATTCGGACACTTTG
GAG
AGCACACCCATGCTGGAGAAGGAGAAGTTCCCACAGGACTACTTTCCTGAGTGCAAATGGTCAAGAA
AA
GGCTTCATCAGGACGCGGTGGTGCATTGCTGACTGTGCCTTCGACTTGGTGAACATTCATCTTTTTCA
T
GATGCATCCAACTTAGTGGCCTGGGAGACAAGCCCCTCAGTGTACTCCGGTGTCAGGCACAAGGCTCTG
GGC
TATGTGCTGGACAGAATCATCGACCAGCGATTTGAGAAAGTTTCCTACTTTGTCTTCGGTGATTTCA
AC
TTCCGCCTGGATTCCAAGTCTGTCGTAGAGACACTCTGCACAAAGGCCACAATGCAGACAGTCCGCGC
T
GCTGATACCAATGAAGTTGTAAAGTTGATATTTCGGGAGTCAGACAATGACCGGAAGGTCGTGCTCCAG
TTG
GAAAAGAAGCTCTTCGACTACTTCAACCAGGATGTCTTCCGGGACAACAACGGCACTGCGCTCTTGG
AA
TTTGACAAGGAGTTGTCTGTCTTTAAGGACAGACTGTATGAACTGGACATCTCATTCCCCCCCAGCTA
C
CCGTACAGTGAGGACTCCAGCCAGGGAGAACAGTACATGAACACGAGATGCCCTGCTTGGTGTGATCGC
ATC
CTCATGTCCCTGTCTGCCAAGGAGCTGGTTCTTAAGTCAGAGAGCGAGGAGAAGGTTGCCACCTACG
AC
CACATCGGGCCTAATGTCTGCATGGGAGACCACAAGCCGGTGTTCCTGGCCTTCCGAATCGCACCTGG
G
GCAGGTAAACCTCACGCCCATGTACACAAGTGTTGTGTCGTGCAGTGA


Translation (412 aa):
MAGKAAAPGTAVLLVTANVGSLFDDPENLQKNWLREFYQVLHTHKPHFMALHCQEFGGKNYEASMSHVDK
F
V
KELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYKKVTGKEIYSDTL
E
STPMLEKEKFPQDYFPE
CKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPSVYSGVRHKAL
G
YVLD
RIIDQRFEKVSYFVFGDFNFRLDSKSVVETLCTKATMQTVRAADTNEVVKLIFRESDNDRKVVLQ
L
EKKLFDYFNQDVFRDNNGTA
LLEFDKELSVFKDRLYELDISFPPSYPYSEDSSQGEQYMNTRCPAWCDR
I
LMSLSAKELVLK
SESEEKVATYDHIGPNVCMGDHKPVFLAFRIAPGAGKPHAHVHKCCVVQ



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser