NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS38967.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
38967.1 Public Mus musculus 4 Tardbp 21 106 86 CCDS HistoryNCBI Gene:230908Re-query CCDS DB by CCDS ID:38967.1Re-query CCDS DB by GeneID:230908See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 4, NCBI annotation release 37.1, Ensembl annotation release 47

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 38967.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000105700 ENSMUSP00000101325 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105700Link to Ensembl Protein Viewer:ENSMUSP00000101325Re-query CCDS DB by Nucleotide ID:ENSMUST00000105700Re-query CCDS DB by Protein ID:ENSMUSP00000101325
Original member Current member EBI,WTSI ENSMUST00000105702 ENSMUSP00000101327 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105702Link to Ensembl Protein Viewer:ENSMUSP00000101327Re-query CCDS DB by Nucleotide ID:ENSMUST00000105702Re-query CCDS DB by Protein ID:ENSMUSP00000101327
Original member Current member EBI,WTSI OTTMUST00000025675 OTTMUSP00000011772 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000025675Link to Vega Protein Viewer:OTTMUSP00000011772Re-query CCDS DB by Nucleotide ID:OTTMUST00000025675Re-query CCDS DB by Protein ID:OTTMUSP00000011772
Original member Current member NCBI NM_001008546.2 NP_001008546.1 Accepted alive Link to Nucleotide Sequence:NM_001008546.2Link to Protein Sequence:NP_001008546.1Re-query CCDS DB by Nucleotide ID:NM_001008546Re-query CCDS DB by Protein ID:NP_001008546Link to BLink:NP_001008546.1

Chromosomal Locations for CCDS 38967.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 4Link to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 148617568 148617635 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 148618665 148618791 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 148619184 148619354 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 148620592 148620732 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 148621949 148622112 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 148625125 148625362 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (909 nt):
ATGTCTGAATATATTCGGGTAACAGAAGATGAGAACGATGAACCCATTGAAATACCATCAGAAGACGATG
GG
ACGGTGTTGCTGTCCACAGTTACAGCCCAGTTTCCAGGGGCATGCGGCCTGCGCTACCGGAATCCCGT
G
TCTCAGTGTATGAGAGGAGTCCGACTGGTGGAAGGAATTCTGCATGCCCCAGATGCTGGCTGGGGCAAT
CTG
GTATATGTTGTCAACTATCCCAAAGATAACAAAAGGAAAATGGATGAGACAGATGCTTCCTCTGCAG
TG
AAAGTGAAAAGAGCAGTCCAGAAAACATCTGACCTCATAGTGTTGGGTCTCCCCTGGAAAACAACTGA
G
CAGGATCTGAAAGACTATTTCAGTACTTTTGGAGAGGTTCTTATGGTTCAGGTCAAGAAAGATCTTAAA
ACT
GGTCACTCGAAAGGGTTTGGCTTTGTTCGATTTACAGAATATGAAACCCAAGTGAAAGTAATGTCAC
AA
CGACATATGATAGATGGGCGATGGTGTGACTGTAAACTTCCCAACTCTAAGCAAAGCCCAGACGAGCC
T
TTGAGAAGCAGAAAGGTGTTTGTTGGACGTTGTACAGAGGACATGACTGCTGAAGAGCTTCAGCAGTTT
TTC
TGTCAGTATGGAGAAGTGGTAGATGTCTTCATTCCCAAACCATTCAGAGCTTTTGCCTTCGTCACCT
TT
GCAGATGATAAGGTTGCCCAGTCTCTTTGTGGAGAGGATTTGATCATTAAAGGAATCAGCGTGCATAT
A
TCCAATGCTGAACCTAAGCATAATAGCAATAGACAGTTAGAAAGAAGTGGAAGATTTGGTGGTAATCCA
G
GA
ATACTTCTGTCTACATGCTTTCTCATCCAAGAATTCGTCATCACGCTGCACAGGCTGCGTCTTTGA


Translation (302 aa):
MSEYIRVTEDENDEPIEIPSEDDGTVLLSTVTAQFPGACGLRYRNPVSQCMRGVRLVEGILHAPDAGWGN
L
VYVVNYPK
DNKRKMDETDASSAVKVKRAVQKTSDLIVLGLPWKTTEQDLKDYFSTFGEVLMVQVKKDLK
T
GHSKGFGFVRFTEYETQVKVMSQRHMIDGRWCDCKLPNSK
QSPDEPLRSRKVFVGRCTEDMTAEELQQF
F
CQYGEVVDVFIPKPFRAFAFVTFADDK
VAQSLCGEDLIIKGISVHISNAEPKHNSNRQLERSGRFGGNP
G
ILLSTCFLIQEFVITLHRLRL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser