NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16921.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16921.1 Public Mus musculus 2 Bpifb3 21 106 86 CCDS HistoryNCBI Gene:378700Re-query CCDS DB by CCDS ID:16921.1Re-query CCDS DB by GeneID:378700See the combined annotation on chromosome 2 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 16921.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000088950 ENSMUSP00000086342 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000088950Link to Ensembl Protein Viewer:ENSMUSP00000086342Re-query CCDS DB by Nucleotide ID:ENSMUST00000088950Re-query CCDS DB by Protein ID:ENSMUSP00000086342
Original member Current member EBI,WTSI ENSMUST00000109760 ENSMUSP00000105382 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000109760Link to Ensembl Protein Viewer:ENSMUSP00000105382Re-query CCDS DB by Nucleotide ID:ENSMUST00000109760Re-query CCDS DB by Protein ID:ENSMUSP00000105382
Original member Current member EBI,WTSI OTTMUST00000040942 OTTMUSP00000018317 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000040942Link to Vega Protein Viewer:OTTMUSP00000018317Re-query CCDS DB by Nucleotide ID:OTTMUST00000040942Re-query CCDS DB by Protein ID:OTTMUSP00000018317
Original member Current member EBI,WTSI OTTMUST00000040943 OTTMUSP00000018318 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000040943Link to Vega Protein Viewer:OTTMUSP00000018318Re-query CCDS DB by Nucleotide ID:OTTMUST00000040943Re-query CCDS DB by Protein ID:OTTMUSP00000018318
Original member Current member NCBI NM_194357.1 NP_919338.2 Accepted alive Link to Nucleotide Sequence:NM_194357.1Link to Protein Sequence:NP_919338.2Re-query CCDS DB by Nucleotide ID:NM_194357Re-query CCDS DB by Protein ID:NP_919338Link to BLAST:NP_919338.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_919338.2 473 Q80ZU7 473 100% 0 0

Chromosomal Locations for CCDS 16921.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 153919633 153919747 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153920490 153920646 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153922146 153922250 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153922567 153922707 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153923837 153923900 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153924761 153924821 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153925535 153925626 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153925744 153925923 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153927286 153927339 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153928654 153928824 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153929310 153929377 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153930507 153930549 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153931413 153931476 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153931890 153931966 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 153932708 153932737 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1422 nt):
ATGATGCTGGGTGTGTATACCCTGCTTCTGCTCTGGGGCCTGGCCACTCCATGCCTGGGGCTGCTTGAGA
CA
GTGGGCACGCTTGCTCGGATTGACAAGGATGAACTGGGCAAAGCCATCCAGAACTCCCTAGTTGGGGG
C
CCTATTCTGCAAAACGTGCTGGGGACTGTGACATCAGTGAACCAGGGCCTCCTGGGTGCAGGAGGGCTG
CTC
GGAGGTGGTGGCCTGCTGAGTTACGGTGGCATCTTTAGTCTTGTGGAAGAACTCTCTGGGCTGAAGA
TA
GAGGAACTAACTTTGCCCAAAGTGTCACTCAAGCTGCTGCCGGGGGTCGGGGTGCAGCTGAACCTGCA
C
ACCAAGGTTAGCCTGCATGGCTCCGGTCCCCTGGTGGGCCTCCTGCAGCTGGCCGCAGAGGTGAACGTG
TCT
TCGAAAGTGGCACTGGGCATGAGTCCTCGGGGGACACCCATCCTTGTCCTTAAGCGCTGCAGCACGC
TC
CTGGGTCACATCAGTCTGATGTCAGGGCTGCTGCCCACGCCAATCTTTGGGCTCGTAGAACAGACACT
G
TGCAAGGTGCTGCCTGGACTGCTGTGCCCTGTGGTAGACAGTGTGCTGAGTGTGGTGAATGAGCTCTTG
GGA
GCTACGCTGAGCCTGGTGCCCCTTGGGCCTCTGGGGTCTGTGGAGTTCACTCTGGCTACACTTCCCC
TA
ATCTCCAACCAGTACATTGAGCTGGATATAAATCCCATCGTGAAGAGCATAGCTGGAGATGTCATTGA
T
TTCCCCAAGCCACGCATCCCAGTCAAGGTGCCCCCCAAAGAGGACCACACCTCCCAAGTGACTGTCCCA
CTC
TATCTCTTCAGCACCGTGTTTGGGCTCCTGCAAACCAACGGTGCCCTTGACCTGGACATCACCCCTG
AG
ATGGTTCCCAGGAATGTCCCTCTGACAACTACTGACCTGGCAGCTTTGGCTCCTGAGGCCCTGGGGAA
A
CTGCCCCCTGCTCAGCACCTCCTGCTCTCGCTGCGGGTGACAAAATCGCCCATGGTCCTGCTGCAGAAC
AAG
AAGGCCACAGTCTCCATCCCAGTCACCATCCATGTGCTGTCTTCTGTCCCTCAAGGAACTCCTGTAG
CC
CTTTTCCAGTTGAATGGGGTTATGACTCTAAATGCCCACCTGGCTCCATCCTCTACCAAGCTGCACAT
A
TCTCTGTCCCTGGAACGGCTAAGTGTCCAGCTGGCCTCCTCCTTTCCCCAACCTTTTGATGCATCCCGT
CTG
GAAGAATGGCTCAGTGATGTGGTCCGGGCTGCCTACATGCAGAGGCTCAACGAGCACCTGGAGGTTG
GA
ATTCCCCTGCCTAAGATTCTCAATGTCAACTTTGCCAATTCAGTGGTCGATATCATTGAGAATGCAGT
T
GTGCTCACAGTGGCTCCGTGA


Translation (473 aa):
MMLGVYTLLLLWGLATPCLGLLETVGTLARIDKDELGKAIQNSLVGGPILQNVLGTVTSVNQGLLGAGGL
L
GGGGLLSYGGIFSLVEELS
GLKIEELTLPKVSLKLLPGVGVQLNLHTKVSLHGSGPLVGLLQLAAEVNV
S
SKVALGMSPRGTPILVLKRCSTLLGHISLMS
GLLPTPIFGLVEQTLCKVLPGLLCPVVDSVLSVVNELL
G
ATL
SLVPLGPLGSVEFTLATLPLISNQYIELDINPIVKSIAGDVIDFPKPRIPVKVPPKEDHTSQVTVP
L
YLFSTVFGLLQTNGALDLDITPEM
VPRNVPLTTTDLAALAPEALGKLPPAQHLLLSLRVTKSPMVLLQN
K
KATVSIPVTIHVLSSVPQGTPVALFQLNG
VMTLNAHLAPSSTKLHISLSLERLSVQLASSFPQPFDASR
L
EEWLSDVVRAAYMQRLN
EHLEVGIPLPKILNVNFANSVVDIIENAVVLTVAP



Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser