NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS18838.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
18838.1 Public Mus musculus 4 Htr6 21 106 86 CCDS HistoryNCBI Gene:15565Re-query CCDS DB by CCDS ID:18838.1Re-query CCDS DB by GeneID:15565See the combined annotation on chromosome 4 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 18838.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000068036 ENSMUSP00000068333 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000068036Link to Ensembl Protein Viewer:ENSMUSP00000068333Re-query CCDS DB by Nucleotide ID:ENSMUST00000068036Re-query CCDS DB by Protein ID:ENSMUSP00000068333
Original member Current member EBI,WTSI ENSMUST00000105802 ENSMUSP00000101428 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000105802Link to Ensembl Protein Viewer:ENSMUSP00000101428Re-query CCDS DB by Nucleotide ID:ENSMUST00000105802Re-query CCDS DB by Protein ID:ENSMUSP00000101428
Original member Current member EBI,WTSI OTTMUST00000022954 OTTMUSP00000010478 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000022954Link to Vega Protein Viewer:OTTMUSP00000010478Re-query CCDS DB by Nucleotide ID:OTTMUST00000022954Re-query CCDS DB by Protein ID:OTTMUSP00000010478
Original member Current member NCBI NM_021358.2 NP_067333.1 Accepted alive Link to Nucleotide Sequence:NM_021358.2Link to Protein Sequence:NP_067333.1Re-query CCDS DB by Nucleotide ID:NM_021358Re-query CCDS DB by Protein ID:NP_067333Link to BLAST:NP_067333.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_067333.1 440 Q9R1C8 440 100% 0 0

Chromosomal Locations for CCDS 18838.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 4 (NC_000070.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4See the combined annotation on chromosome 4 in Sequence Viewer

Chromosome Start Stop Links
4 139061420 139061863 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 139062074 139062232 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4
4 139074042 139074761 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 4Link to Ensembl Genome Browser on chromosome 4Link to Vega Genome Browser on chromosome 4

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1323 nt):
ATGGTTCCAGAGCCCGGCCCTGTCAACAGTAGCACCCCAGCCTGGGGCCCCGGGCCACCGCCAGCCCCAG
GG
GGCAGCGGCTGGGTGGCCGCTGCGCTGTGCGTGGTCATCGTGCTGACGGCAGCCGCCAATTCGCTGCT
G
ATCGCGCTCATCTGCACGCAGCCCGCGCTGCGCAACACGTCTAACTTCTTCCTGGTGTCGCTCTTCACG
TCG
GACCTGATGGTGGGATTGGTGGTGATGCCCCCAGCCATGCTGAACGCGCTGTATGGGCGCTGGGTGC
TA
GCTCGCGGCCTCTGTCTGCTTTGGACCGCCTTCGACGTGATGTGCTGCAGCGCCTCCATTCTCAACCT
C
TGCCTCATCAGCCTGGACCGCTACCTGCTCATCCTCTCGCCGCTGCGCTACAAGCTGCGCATGACAGCC
CCG
CGTGCCCTGGCGCTCATCCTGGGTGCCTGGAGCCTCGCCGCGCTGGCCTCCTTCCTGCCCCTCTTGC
TG
GGCTGGCATGAACTGGGCAAAGCTCGAACATCTGCCCCGGGCCAGTGCCGCCTATTGGCCAGCCTGCC
T
TATGTCCTCGTGGCGTCCGGCGTCACCTTTTTCCTGCCTTCGGGTGCCATCTGCTTCACCTACTGCAGG
ATC
TTGCTGGCTGCCCGCAAGCAGGCGGTGCAAGTGGCCTCGCTCACCACGGGCACGGCTACGGCTGGCC
AG
GCCTTGGAAACCTTGCAGGTGCCCAGGACACCACGCCCAGGGATGGAGTCTGCTGACAGTAGGCGTCT
G
ACCACCAAGCATAGCAGGAAGGCCTTGAAGGCCAGCCTGACCCTCGGCATCCTGCTGAGCATGTTCTTT
GTC
ACCTGGCTGCCCTTCTTTGTGGCCAGCATAGCTCAGGCCGTATGTGACTGCATCTCTCCAGGTCTCT
TC
GATGTCCTCACATGGCTGGGATACTGTAATAGCACCATGAACCCTATCATCTATCCCCTCTTCATGCG
G
GACTTCAAGAGGGCCCTGGGCAGGTTCGTGCCGTGTGTCCACTGTCCCCCGGAGCACCGGGCCAGCCCC
GCC
TCCCCCTCCATGTGGACCTCTCACAGTGGTGCCAGGCCAGGCCTCAGCCTGCAGCAGGTGCTGCCCC
TG
CCTCTGCCACCCAACTCAGATTCAGACTCAGCTTCAGGGGGCACCTCGGGCCTGCAGCTCACAGCCCA
G
CTTTTGCTGCCTGGAGAGGCGACCCGGGACCCCCCGCCACCCACCAGGGCCCCTACTGTGGTCAACTTC
TTC
GTCACAGACTCTGTGGAGCCTGAGATACGGCAGCATCCACTTGGTTCCCCCATGAACTGA


Translation (440 aa):
MVPEPGPVNSSTPAWGPGPPPAPGGSGWVAAALCVVIVLTAAANSLLIALICTQPALRNTSNFFLVSLFT
S
DLMVGLVVMPPAMLNALYGRWVLARGLCLLWTAFDVMCCSASILNLCLISLDRYLLILSPLRYKLRMTA
P
RALALILGAWSLAALASFLPLLLGWHELGKARTSAPGQCRLLASLPYVLVASGVTFFLPSGAICFTYCR
I
LLAARKQAVQVASLTTGTATAGQALETLQ
VPRTPRPGMESADSRRLTTKHSRKALKASLTLGILLSMFF
V
TWLPFFVASIAQ
AVCDCISPGLFDVLTWLGYCNSTMNPIIYPLFMRDFKRALGRFVPCVHCPPEHRASP
A
SPSMWTSHSGARPGLSLQQVLPLPLPPNSDSDSASGGTSGLQLTAQLLLPGEATRDPPPPTRAPTVVNF
F
VTDSVEPEIRQHPLGSPMN




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser