NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS24719.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
24719.1 Public Mus musculus 11 Galnt10 21 106 86 CCDS HistoryNCBI Gene:171212Re-query CCDS DB by CCDS ID:24719.1Re-query CCDS DB by GeneID:171212See the combined annotation on chromosome 11 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 24719.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000066987 ENSMUSP00000065096 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000066987Link to Ensembl Protein Viewer:ENSMUSP00000065096Re-query CCDS DB by Nucleotide ID:ENSMUST00000066987Re-query CCDS DB by Protein ID:ENSMUSP00000065096
Original member Current member EBI,WTSI OTTMUST00000012702 OTTMUSP00000005884 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000012702Link to Vega Protein Viewer:OTTMUSP00000005884Re-query CCDS DB by Nucleotide ID:OTTMUST00000012702Re-query CCDS DB by Protein ID:OTTMUSP00000005884
Original member Current member NCBI NM_134189.2 NP_598950.2 Accepted alive Link to Nucleotide Sequence:NM_134189.2Link to Protein Sequence:NP_598950.2Re-query CCDS DB by Nucleotide ID:NM_134189Re-query CCDS DB by Protein ID:NP_598950Link to BLink:NP_598950.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_598950.2 603 Q6P9S7 603 100% 0 0

Chromosomal Locations for CCDS 24719.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 11 (NC_000077.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 11Link to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11See the combined annotation on chromosome 11 in Sequence Viewer

Chromosome Start Stop Links
11 57645559 57645717 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57721295 57721397 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57725523 57725661 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57736978 57737144 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57765560 57765745 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57769492 57769675 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57771468 57771585 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57777631 57777738 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57781050 57781271 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57782206 57782322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57783690 57783839 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11
11 57784570 57784728 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 11Link to Ensembl Genome Browser on chromosome 11Link to Vega Genome Browser on chromosome 11

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1812 nt):
ATGAGGCGCAAAGAGAAGCGGCTCTTGCAGGCGGTGGCTCTGGCTCTGGCGGCCCTGGTCCTGCTGCCCA
AC
GTGGGGCTTTGGGCTCTGTACCGCGAGCGGCAGCCCGACGGCAGCCCTGGGGGATTGGGGGCGGCGGT
G
GCCCCCGCGGCGGTTCAGGAATTACACAGTCGACAAAAAAAGACATTTTTCTTGGGAGCTGAACAAAGG
CTG
AAGGACTGGCATAACAAGGAGGCTATCAGGAGGGACGCACAGCGCGTAGGATATGGAGAACAGGGGA
AG
CCTTACCCCATGACCGATGCCGAGAGAGTGGACCAGGCGTACCGGGAAAATGGATTTAACATCTACGT
C
AGTGATAAAATCTCCCTGAATCGCTCTCTCCCCGATATCCGGCACCCAAACTGTAACAGCAAGCTCTAC
CTG
GAGACGCTCCCCAACACCAGCATCATCATCCCCTTCCACAACGAGGGCTGGTCCTCACTGCTGCGCA
CT
GTTCACAGCGTGCTCAACCGCTCGCCCCCAGAGCTAGTGGCGGAGATTGTGTTGGTCGATGACTTCAG
T
GATCGAGAGCACCTGAAGAAGCCCCTGGAGGACTACATGGCCCTTTTCCCCAGCGTGAGGATTCTCCGG
ACC
AAGAAACGGGAAGGCCTGATAAGGACCCGAATGCTGGGGGCATCAGCTGCCACCGGAGATGTCGTCA
CT
TTCTTAGATTCACACTGTGAAGCCAACGTCAACTGGCTCCCCCCTTTGCTTGACCGCATTGCTCGGAA
C
CGGAAGACCATCGTGTGCCCAATGATCGATGTCATCGACCACGATGACTTCCGGTATGAGACTCAGGCT
GGG
GACGCCATGCGTGGTGCCTTCGACTGGGAAATGTATTACAAACGGATCCCAATCCCTCCAGAGCTGC
AG
AAGGCTGACCCCAGTGACCCATTTGAGTCTCCCGTGATGGCTGGAGGGTTGTTCGCTGTGGACCGGAA
A
TGGTTCTGGGAGTTGGGTGGCTATGACCCTGGCTTGGAGATCTGGGGAGGAGAGCAGTATGAGATCTCC
TTC
AAGGTGTGGATGTGTGGGGGCCGCATGGAGGACATCCCCTGCTCCAGAGTGGGCCACATCTACAGGA
AG
TATGTGCCCTACAAGGTCCCTGCCGGAGTCAGCCTGGCCCGGAACCTGAAGCGAGTGGCAGAGGTATG
G
ATGGATGAATACGCAGAATACATCTACCAGCGCAGGCCGGAGTACCGCCACCTCTCAGCTGGAGATGTC
GTG
GCCCAGAAAAAGCTCCGAGTCTCCCTCAACTGTAAGAGCTTCAAGTGGTTTATGACCAAAATTGCCT
GG
GACCTGCCCAAGTTCTACCCACCCGTGGAACCTCCGGCTGCGGCATGGGGGGAGATTCGCAATGTGGG
C
ACAGGACTGTGCACAGACACGAAGCTTGGCACACTGGGCTCCCCACTGAGGCTCGAGACCTGCATCCGG
GGC
CGAGGCGAGGCTGCTTGGAACAGTATGCAGGTCTTTACCTTCACCTGGCGGGAGGACATCCGGCCTG
GA
GACCCTCAGCACACCAAGAAGTTTTGCTTCGACGCTGTCTCCCACACCAGCCCAGTCACCCTCTACGA
C
TGCCACAGCATGAAGGGCAACCAGCTGTGGAAATACCGCAAGGACAAGACGCTGTACCACCCTGTGAGC
GGC
AGCTGCATGGACTGCAGCGAGAGTGACCACAGGGTCTTCATGAACACCTGCAATCCCTCCTCCCTCA
CC
CAGCAGTGGCTCTTTGAACACACCAACTCGACGGTCTTAGAGAATTTCAACAAGAACTGA


Translation (603 aa):
MRRKEKRLLQAVALALAALVLLPNVGLWALYRERQPDGSPGGLGAAVAPAAVQELHSRQKKTFFLGAEQR
L
KDWHNKEAIRRDAQRV
GYGEQGKPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKLY
L
ETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDR
EHLKKPLEDYMALFPSVRILR
T
KKREGLIRTRMLGASAATGDVVTFLDSHCEANVNWLPPLL
DRIARNRKTIVCPMIDVIDHDDFRYETQA
G
DAMRGAFDWEMYYKRIPIPPELQKADPSDPF
ESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEIS
F
K
VWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDV
V
AQKKLRVSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGE
IRNVGTGLCTDTKLGTLGSPLRLETCIR
G
RGEAAWNSMQ
VFTFTWREDIRPGDPQHTKKFCFDAVSHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVS
G
SCMDCSESDHRVFMNTCNPSSLTQQWLFEHTNSTVLENFNKN




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser