NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS16973.2 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
16973.2 Public Mus musculus 2 Samhd1 21 106 86 CCDS HistoryNCBI Gene:56045Re-query CCDS DB by CCDS ID:16973.2Re-query CCDS DB by GeneID:56045See the combined annotation on chromosome 2 in Sequence Viewer

Public Note for CCDS 16973.1
The coding region has been updated to extend the N-terminus to one that is more supported by available transcript data.

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq, Havana and CCDS collaboration)

Sequence IDs included in CCDS 16973.2

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000057725 ENSMUSP00000059717 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000057725Link to Ensembl Protein Viewer:ENSMUSP00000059717Re-query CCDS DB by Nucleotide ID:ENSMUST00000057725Re-query CCDS DB by Protein ID:ENSMUSP00000059717
Original member Current member EBI,WTSI OTTMUST00000038703 OTTMUSP00000017309 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000038703Link to Vega Protein Viewer:OTTMUSP00000017309Re-query CCDS DB by Nucleotide ID:OTTMUST00000038703Re-query CCDS DB by Protein ID:OTTMUSP00000017309
Original member Current member NCBI NM_018851.3 NP_061339.3 Accepted alive Link to Nucleotide Sequence:NM_018851.3Link to Protein Sequence:NP_061339.3Re-query CCDS DB by Nucleotide ID:NM_018851Re-query CCDS DB by Protein ID:NP_061339Link to BLAST:NP_061339.3

Chromosomal Locations for CCDS 16973.2

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 2 (NC_000068.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 2Link to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2See the combined annotation on chromosome 2 in Sequence Viewer

Chromosome Start Stop Links
2 157099399 157099503 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157101721 157101858 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157104832 157104936 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157106231 157106323 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157107429 157107565 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157109417 157109532 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157110548 157110639 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157112800 157112941 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157114222 157114322 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157116352 157116507 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157120482 157120552 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157121831 157121946 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157123289 157123449 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157126772 157126844 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157129850 157129916 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2
2 157134879 157135182 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 2Link to Ensembl Genome Browser on chromosome 2Link to Vega Genome Browser on chromosome 2

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1977 nt):
ATGGACTCACTTTTGGGGTGTGGTGTCAGTGCGGCTGCGCGCGAGCCGGTGCCGCGGTACTTAACTTCGC
AG
CCCCGGGTGTCGGAGGTAGCCATGCAGAGCGCACCCTTGGAGCAGCCAGCTAAGCGACCCCGCTGCGA
T
GGCAGCCCAAGGACGCCACCGAGCACTCCTCCTGCAACAGCTAATCTGTCTGCAGACGACGACTTCCAA
AAC
ACCGACCTCCGAACCTGGGAACCGGAGGACGTGTGCTCCTTCTTAGAGAATCGTGGTTTCCGAGAGA
AG
AAAGTGCTGGACATCTTCAGAGACAATAAAATCGCCGGCTCGTTTCTGCCCTTTTTGGATGAGGATCG
T
CTGGAAGATCTGGGAGTAAGTTCCTTGGAGGAGAGGAAGAAGATGATAGAATGTATCCAGCAGCTGAGT
CAG
TCTCGGATTGATCTAATGAAGGTATTTAATGATCCCATTCATGGCCACATTGAGTTCCACCCTCTCC
TT
ATCAGAATCATCGACACACCTCAGTTCCAGCGACTTCGCTATATCAAGCAGCTGGGGGGCGGCTACTA
T
GTTTTCCCTGGAGCGTCCCACAATCGCTTCGAACACAGTCTCGGAGTGGGGTACCTAGCAGGCTGCCTG
GTG
CGAGCACTTGCCGAAAAACAGCCAGAGCTACAGATCAGTGAGCGAGATATACTCTGTGTTCAGATTG
CG
GGGCTCTGCCACGACCTAGGTCATGGGCCATTTTCTCATATGTTTGATGGAAGGTTTATCCCACGGGC
T
CGCCCAGAGAAAAAGTGGAAGCACGAACAGGGCTCCATTGAGATGTTTGAGCATCTGGTCAATTCTAAT
GAA
CTCAAACTTGTCATGAAGAACTATGGTCTCGTCCCTGAAGAAGACATTACCTTTATCAAGGAACAAA
TT
ATGGGACCACCTATAACACCAGTCAAAGATTCCTTGTGGCCGTATAAAGGCCGCCCTGCCACGAAGAG
C
TTCCTTTACGAGATAGTGTCTAACAAGAGGAATGGCATCGACGTAGACAAATGGGATTATTTTGCCAGA
GAC
TGTCACCATCTTGGAATCCAAAATAATTTTGATTACAAGCGCTTCATTAAGTTTGCCCGTATCTGTG
AA
GTGGAGTACAAGGTCAAGGAGGACAAGACCTACATCCGTAAGGTGAAGCACATTTGTTCGAGAGAAAA
G
GAGGTTGGAAATCTGTATGACATGTTCCACACTCGCAACTGCTTACACCGAAGAGCTTACCAACACAAG
ATC
AGCAACCTCATCGACATAATGATTACAGATGCCTTCCTCAAAGCAGACCCCTACGTGGAGATTACAG
GG
ACTGCCGGGAAGAAGTTCCGCATTTCCACAGCCATTGATGACATGGAAGCCTTCACTAAGTTGACGGA
T
AACATTTTTCTGGAGGTTTTACACTCTACTGATCCACAGTTGTCTGAGGCCCAAAGTATTTTAAGGAAC
ATT
GAATGCCGCAATCTATACAAGTATTTGGGTGAGACCCAGCCAAAGCGTGAGAAGATTAGGAAGGAAG
AA
TATGAACGGCTTCCCCAAGAAGTTGCTAAAGCCAAACCTGAAAAAGCCCCGGATGTTGAACTGAAGGC
C
GAAGATTTCATAGTTGATGTTATCAATGTGGATTATGGGATGGAAGACAAGAATCCAATCGATCGTGTT
CAC
TTCTATTGTAAGAGCAACAGCAAGCAAGCGGTCAGGATCAATAAAGAGCAGGTGTCACAACTGCTGC
CA
GAGAAATTTGCAGAGCAGCTCATTCGGGTGTACTGTAAGAAGAAAGACGGGAAGAGCCTGGACGCCGC
C
GGGAAGCACTTTGTTCAGTGGTGTGCGCTCAGGGACTTCACCAAGCCACAGGATGGTGACATTATAGCT
CCA
CTCATAACACCTCTGAAATGGAATAATAAGACTTCATCTTGCCTCCAAGAAGTATCCAAAGTAAAAA
CA
TGTCTAAAATTTTAA


Translation (658 aa):
MDSLLGCGVSAAAREPVPRYLTSQPRVSEVAMQSAPLEQPAKRPRCDGSPRTPPSTPPATANLSADDDFQ
N
TDLRTWEPEDVCSFLENRGFREKKVLDIFR
DNKIAGSFLPFLDEDRLEDLGVSSLEERKKMIECIQQLS
Q
SRIDLMK
VFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCL
V
RALAEKQPELQISERDILCVQIAGLCHDL
GHGPFSHMFDGRFIPRARPEKKWKHEQGSIEMFEHLVNSN
E
LKLVMKNYGLVPEEDITFIKEQIMGPPITPVKDSL
WPYKGRPATKSFLYEIVSNKRNGIDVDKWDYFAR
D
CHHLGIQNNFDYKRFIKFARICEVEYKVKEDKTYIRKVKHICSREK
EVGNLYDMFHTRNCLHRRAYQHK
I
SNLIDI
MITDAFLKADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRN
I
ECRNLYKYLGETQPKREKIRK
EEYERLPQEVAKAKPEKAPDVELKAEDFIVDVINVDYGMEDKNPIDRV
H
FYCKSNSKQAVRINKEQ
VSQLLPEKFAEQLIRVYCKKKDGKSLDAAGKHFVQWCALRDFTKPQDGDIIA
P
LITPLKWNNKTSSCLQEVSKVKTCLKF




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser