NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS30319.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
30319.1 Public Mus musculus X Cxcr3 21 106 86 CCDS HistoryNCBI Gene:12766Re-query CCDS DB by CCDS ID:30319.1Re-query CCDS DB by GeneID:12766See the combined annotation on chromosome X in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 30319.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000056614 ENSMUSP00000052444 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000056614Link to Ensembl Protein Viewer:ENSMUSP00000052444Re-query CCDS DB by Nucleotide ID:ENSMUST00000056614Re-query CCDS DB by Protein ID:ENSMUSP00000052444
Original member Current member EBI,WTSI OTTMUST00000043946 OTTMUSP00000019734 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000043946Link to Vega Protein Viewer:OTTMUSP00000019734Re-query CCDS DB by Nucleotide ID:OTTMUST00000043946Re-query CCDS DB by Protein ID:OTTMUSP00000019734
Original member Current member NCBI NM_009910.3 NP_034040.1 Accepted alive Link to Nucleotide Sequence:NM_009910.3Link to Protein Sequence:NP_034040.1Re-query CCDS DB by Nucleotide ID:NM_009910Re-query CCDS DB by Protein ID:NP_034040Link to BLink:NP_034040.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_034040.1 367 O88410 367 100% 0 0

Chromosomal Locations for CCDS 30319.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome X (NC_000086.7)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome XLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome XSee the combined annotation on chromosome X in Sequence Viewer

Chromosome Start Stop Links
X 101731951 101733042 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X
X 101734047 101734058 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome XLink to Ensembl Genome Browser on chromosome XLink to Vega Genome Browser on chromosome X

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1104 nt):
ATGTACCTTGAGGTTAGTGAACGTCAAGTGCTAGATGCCTCGGACTTTGCCTTTCTTCTGGAAAACAGCA
CC
TCTCCCTACGATTATGGGGAAAACGAGAGCGACTTCTCTGACTCCCCGCCCTGCCCACAGGATTTCAG
C
CTGAACTTTGACAGAACCTTCCTGCCAGCCCTCTACAGCCTCCTCTTCTTGCTGGGGCTGCTAGGCAAT
GGG
GCGGTGGCTGCTGTGCTACTGAGTCAGCGCACTGCCCTGAGCAGCACGGACACCTTCCTGCTCCACC
TG
GCTGTAGCCGATGTTCTGCTGGTGTTAACTCTTCCATTGTGGGCAGTGGATGCTGCTGTCCAGTGGGT
T
TTCGGCCCTGGCCTCTGCAAAGTGGCAGGCGCCTTGTTCAACATCAACTTCTATGCAGGGGCCTTCCTG
CTG
GCTTGTATAAGCTTCGACAGATATCTGAGCATAGTGCACGCCACCCAGATCTACCGCAGGGACCCCC
GG
GTACGTGTAGCCCTCACCTGCATAGTTGTATGGGGTCTCTGTCTGCTCTTTGCCCTCCCAGATTTCAT
C
TACCTATCAGCCAACTACGATCAGCGCCTCAATGCCACCCATTGCCAGTACAACTTCCCACAGGTGGGT
CGC
ACTGCTCTGCGTGTACTGCAGCTAGTGGCTGGTTTCCTGCTGCCCCTTCTGGTCATGGCCTACTGCT
AT
GCCCATATCCTAGCTGTTCTGCTGGTCTCCAGAGGCCAGAGGCGTTTTCGAGCTATGAGGCTAGTGGT
A
GTGGTGGTGGCAGCCTTTGCTGTCTGCTGGACCCCCTATCACCTGGTGGTGCTAGTGGATATCCTCATG
GAT
GTGGGAGTTTTGGCCCGCAACTGTGGTCGAGAAAGCCACGTGGATGTGGCCAAGTCAGTCACCTCGG
GC
ATGGGGTACATGCACTGCTGCCTCAATCCGCTGCTCTATGCCTTTGTGGGAGTGAAGTTCAGAGAGCA
A
ATGTGGATGTTGTTCACGCGCCTGGGCCGCTCTGACCAGAGAGGGCCCCAGCGGCAGCCGTCATCTTCA
CGG
AGAGAATCATCCTGGTCTGAGACAACTGAGGCCTCCTACCTGGGCTTGTAA


Translation (367 aa):
MYLEVSERQVLDASDFAFLLENSTSPYDYGENESDFSDSPPCPQDFSLNFDRTFLPALYSLLFLLGLLGN
G
AVAAVLLSQRTALSSTDTFLLHLAVADVLLVLTLPLWAVDAAVQWVFGPGLCKVAGALFNINFYAGAFL
L
ACISFDRYLSIVHATQIYRRDPRVRVALTCIVVWGLCLLFALPDFIYLSANYDQRLNATHCQYNFPQVG
R
TALRVLQLVAGFLLPLLVMAYCYAHILAVLLVSRGQRRFRAMRLVVVVVAAFAVCWTPYHLVVLVDILM
D
VGVLARNCGRESHVDVAKSVTSGMGYMHCCLNPLLYAFVGVKFREQMWMLFTRLGRSDQRGPQRQPSSS
R
RESSWSETTEASYLGL




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser