NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS19579.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
19579.1 Public Mus musculus 5 Acads 21 106 86 CCDS HistoryNCBI Gene:11409Re-query CCDS DB by CCDS ID:19579.1Re-query CCDS DB by GeneID:11409See the combined annotation on chromosome 5 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 19579.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000031524 ENSMUSP00000031524 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000031524Link to Ensembl Protein Viewer:ENSMUSP00000031524Re-query CCDS DB by Nucleotide ID:ENSMUST00000031524Re-query CCDS DB by Protein ID:ENSMUSP00000031524
Original member Current member EBI,WTSI OTTMUST00000034682 OTTMUSP00000015526 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000034682Link to Vega Protein Viewer:OTTMUSP00000015526Re-query CCDS DB by Nucleotide ID:OTTMUST00000034682Re-query CCDS DB by Protein ID:OTTMUSP00000015526
Original member Current member NCBI NM_007383.3 NP_031409.2 Accepted alive Link to Nucleotide Sequence:NM_007383.3Link to Protein Sequence:NP_031409.2Re-query CCDS DB by Nucleotide ID:NM_007383Re-query CCDS DB by Protein ID:NP_031409Link to BLink:NP_031409.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031409.2 412 Q07417 412 100% 0 0

Chromosomal Locations for CCDS 19579.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 5 (NC_000071.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 5Link to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5See the combined annotation on chromosome 5 in Sequence Viewer

Chromosome Start Stop Links
5 115110854 115111006 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115111094 115111150 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115111319 115111414 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115111637 115111774 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115111857 115112027 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115112240 115112391 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115112765 115112876 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115113064 115113213 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115117565 115117728 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5
5 115119225 115119270 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 5Link to Ensembl Genome Browser on chromosome 5Link to Vega Genome Browser on chromosome 5

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1239 nt):
ATGGCTGCCGCCTTGCTCGCCCGGGCCCGTGGCCCTCTCCGTAGAGCTCTCGGTGTTCGGGACTGGCGAC
GG
TTACACACTGTTTACCAGTCTGTGGAGCTGCCTGAGACACACCAGATGTTGCGTCAGACATGCCGTGA
C
TTTGCCGAGAAGGAGTTGGTCCCCATTGCGGCCCAGCTGGACAGGGAGCATCTCTTCCCCACAGCTCAG
GTT
AAGAAGATGGGTGAGCTCGGGCTGCTGGCCATGGATGTGCCAGAGGAGCTGAGTGGTGCAGGCTTGG
AT
TACCTGGCCTACTCCATCGCCCTGGAGGAGATCAGCCGTGCCTGCGCCTCCACGGGAGTTATCATGAG
C
GTCAACAATTCTCTCTACTTGGGACCCATTCTGAAGTTTGGATCCGCACAGCAGAAGCAACAGTGGATC
ACC
CCTTTCACCAATGGTGACAAAATCGGCTGTTTTGCCCTCAGTGAGCCAGGCAATGGCAGTGATGCTG
GA
GCCGCTTCCACCACTGCCCGGGAAGAGGGTGACTCATGGGTCCTCAACGGCACCAAAGCTTGGATCAC
C
AACTCCTGGGAGGCTTCCGCCACGGTGGTATTTGCCAGCACAGACAGGTCCCGGCAGAACAAGGGTATC
AGT
GCCTTCCTGGTTCCCATGCCAACTCCTGGGCTCACGCTGGGCAAGAAGGAAGACAAGCTGGGCATCC
GG
GCCTCCTCCACAGCTAACCTCATCTTTGAGGACTGCCGGATCCCCAAGGAGAACCTGCTTGGGGAGCC
T
GGGATGGGCTTCAAAATAGCCATGCAAACCCTGGACATGGGTCGCATTGGCATCGCCTCCCAGGCCCTG
GGC
ATCGCCCAGGCCTCCCTGGATTGTGCTGTGAAGTATGCCGAGAACCGCAATGCCTTTGGGGCACCGC
TC
ACCAAGCTCCAAAATATCCAGTTCAAGCTGGCAGACATGGCCCTGGCCCTGGAGAGTGCCCGCCTGCT
G
ACCTGGCGTGCTGCCATGTTGAAAGACAACAAGAAACCTTTCACCAAGGAGTCCGCCATGGCCAAACTG
GCT
GCATCGGAGGCTGCAACCGCCATTAGCCACCAGGCCATCCAGATCCTGGGCGGCATGGGGTATGTGA
CA
GAGATGCCGGCTGAGCGGTACTACCGAGATGCCCGCATCACTGAGATCTACGAAGGGACCAGCGAAAT
C
CAGAGACTGGTGATCGCTGGGCATCTGCTCCGGAGCTACCGGAGCTGA


Translation (412 aa):
MAAALLARARGPLRRALGVRDWRRLHTVYQSVELPETHQMLRQTCRDFAEKELVPIAAQLDREHLFPTAQ
V
KKMGELGLLAMDVPEELSGAGLDYLAYSIALEEISRACASTGVIMSVNN
SLYLGPILKFGSAQQKQQWI
T
PFTNGDKIGCFALSEP
GNGSDAGAASTTAREEGDSWVLNGTKAWITNSWEASATVVFASTDRSRQNKGI
S
AFLVPMPTPGLTLGKKEDKLGIRASSTANLIFEDCRIPKENLLGEPGMGFKIAM
QTLDMGRIGIASQAL
G
IAQASLDCAVKYAENRNAFGAPLTKLQNIQ
FKLADMALALESARLLTWRAAMLKDNKKPFTKESAMAKL
A
ASEAATAISHQ
AIQILGGMGYVTEMPAERYYRDARITEIYEGTSEIQRLVIAGHLLRSYRS



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser