NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
UCSC
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS17435.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
17435.1 Public Mus musculus 3 Tlr2 21 106 86 CCDS HistoryNCBI Gene:24088Re-query CCDS DB by CCDS ID:17435.1Re-query CCDS DB by GeneID:24088See the combined annotation on chromosome 3 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 17435.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000029623 ENSMUSP00000029623 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000029623Link to Ensembl Protein Viewer:ENSMUSP00000029623Re-query CCDS DB by Nucleotide ID:ENSMUST00000029623Re-query CCDS DB by Protein ID:ENSMUSP00000029623
Original member Current member EBI,WTSI OTTMUST00000130194 OTTMUSP00000069825 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000130194Link to Vega Protein Viewer:OTTMUSP00000069825Re-query CCDS DB by Nucleotide ID:OTTMUST00000130194Re-query CCDS DB by Protein ID:OTTMUSP00000069825
Original member Current member NCBI NM_011905.3 NP_036035.3 Accepted alive Link to Nucleotide Sequence:NM_011905.3Link to Protein Sequence:NP_036035.3Re-query CCDS DB by Nucleotide ID:NM_011905Re-query CCDS DB by Protein ID:NP_036035Link to BLAST:NP_036035.3

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_036035.3 784 Q9QUN7 784 99.8725% 0 1

Chromosomal Locations for CCDS 17435.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '-' strand of Chromosome 3 (NC_000069.6)
Genome Browser links: Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3See the combined annotation on chromosome 3 in Sequence Viewer

Chromosome Start Stop Links
3 83836420 83838774 Link to NCBI NucleotideLink to UCSC Genome Browser on chromosome 3Link to Ensembl Genome Browser on chromosome 3Link to Vega Genome Browser on chromosome 3

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (2355 nt):
ATGCTACGAGCTCTTTGGCTCTTCTGGATCTTGGTGGCCATAACAGTCCTCTTCAGCAAACGCTGTTCTG
CT
CAGGAGTCTCTGTCATGTGATGCTTCTGGGGTGTGTGATGGCCGCTCCAGGTCTTTCACCTCTATTCC
C
TCCGGACTCACAGCAGCCATGAAAAGCCTTGACCTGTCTTTCAACAAGATCACCTACATTGGCCATGGT
GAC
CTCCGAGCGTGTGCGAACCTCCAGGTTCTGATGTTGAAGTCCAGCAGAATCAATACAATAGAGGGAG
AC
GCCTTTTATTCTCTGGGCAGTCTTGAACATTTGGATTTGTCTGATAATCACCTATCTAGTTTATCTTC
C
TCCTGGTTCGGGCCCCTTTCCTCTTTGAAATACTTAAACTTAATGGGAAATCCTTACCAGACACTGGGG
GTA
ACATCGCTTTTTCCCAATCTCACAAATTTACAAACCCTCAGGATAGGAAATGTAGAGACTTTCAGTG
AG
ATAAGGAGAATAGATTTTGCTGGGCTGACTTCTCTCAATGAACTTGAAATTAAGGCATTAAGTCTCCG
G
AATTATCAGTCCCAAAGTCTAAAGTCGATCCGCGACATCCATCACCTGACTCTTCACTTAAGCGAGTCT
GCT
TTCCTGCTGGAGATTTTTGCAGATATTCTGAGTTCTGTGAGATATTTAGAACTAAGAGATACTAACT
TG
GCCAGGTTCCAGTTTTCACCACTGCCCGTAGATGAAGTCAGCTCACCGATGAAGAAGCTGGCATTCCG
A
GGCTCGGTTCTCACTGATGAAAGCTTTAACGAGCTCCTGAAGCTGTTGCGTTACATCTTGGAACTGTCG
GAG
GTAGAGTTCGACGACTGTACCCTCAATGGGCTCGGCGATTTCAACCCCTCGGAGTCAGACGTAGTGA
GC
GAGCTGGGTAAAGTAGAAACAGTCACTATCCGGAGGTTGCATATCCCCCAGTTCTATTTGTTTTATGA
C
CTGAGTACTGTCTATTCCCTCCTGGAGAAGGTGAAGCGAATCACAGTAGAGAACAGCAAGGTCTTCCTG
GTT
CCCTGCTCGTTCTCCCAGCATTTAAAATCATTAGAATTCTTAGACCTCAGCGAAAATCTGATGGTTG
AA
GAATATTTGAAGAACTCAGCCTGTAAGGGAGCCTGGCCTTCTCTACAAACCTTAGTTTTGAGCCAGAA
T
CATTTGAGATCAATGCAAAAAACAGGAGAGATTTTGCTGACTCTGAAAAACCTGACCTCTCTTGACATC
AGC
AGGAACACTTTTCATCCGATGCCCGACAGCTGTCAGTGGCCAGAAAAGATGCGCTTCCTGAATTTGT
CC
AGTACAGGGATCCGGGTGGTAAAAACGTGCATTCCTCAGACGCTGGAGGTGTTGGATGTTAGTAACAA
C
AATCTTGACTCATTTTCTTTGTTCTTGCCTCGGCTGCAAGAGCTCTATATTTCCAGAAATAAGCTGAAA
ACA
CTCCCAGATGCTTCGTTGTTCCCTGTGTTGCTGGTCATGAAAATCAGAGAGAATGCAGTAAGTACTT
TC
TCTAAAGACCAACTTGGTTCTTTTCCCAAACTGGAGACTCTGGAAGCAGGCGACAACCACTTTGTTTG
C
TCCTGCGAACTCCTATCCTTTACTATGGAGACGCCAGCTCTGGCTCAAATCCTGGTTGACTGGCCAGAC
AGC
TACCTGTGTGACTCTCCGCCTCGCCTGCACGGCCACAGGCTTCAGGATGCCCGGCCCTCCGTCTTGG
AA
TGTCACCAGGCTGCACTGGTGTCTGGAGTCTGCTGTGCCCTTCTCCTGTTGATCTTGCTCGTAGGTGC
C
CTGTGCCACCATTTCCACGGACTGTGGTACCTGAGAATGATGTGGGCGTGGCTCCAGGCCAAGAGGAAG
CCC
AAGAAAGCTCCCTGCAGGGACGTTTGCTATGATGCCTTTGTTTCCTACAGTGAGCAGGATTCCCATT
GG
GTGGAGAACCTCATGGTCCAGCAGCTGGAGAACTCTGACCCGCCCTTTAAGCTGTGTCTCCACAAGCG
G
GACTTCGTTCCGGGCAAATGGATCATTGACAACATCATCGATTCCATCGAAAAGAGCCACAAAACTGTG
TTC
GTGCTTTCTGAGAACTTCGTACGGAGCGAGTGGTGCAAGTACGAACTGGACTTCTCCCACTTCAGGC
TC
TTTGACGAGAACAACGACGCGGCCATCCTTGTTTTGCTGGAGCCCATTGAGAGGAAAGCCATTCCCCA
G
CGCTTCTGCAAACTGCGCAAGATAATGAACACCAAGACCTACCTGGAGTGGCCCTTGGATGAAGGCCAG
CAG
GAAGTGTTTTGGGTAAATCTGAGAACTGCAATAAAGTCCTAG


Translation (784 aa):
MLRALWLFWILVAITVLFSKRCSAQESLSCDASGVCDGRSRSFTSIPSGLTAAMKSLDLSFNKITYIGHG
D
LRACANLQVLMLKSSRINTIEGDAFYSLGSLEHLDLSDNHLSSLSSSWFGPLSSLKYLNLMGNPYQTLG
V
TSLFPNLTNLQTLRIGNVETFSEIRRIDFAGLTSLNELEIKALSLRNYQSQSLKSIRDIHHLTLHLSES
A
FLLEIFADILSSVRYLELRDTNLARFQFSPLPVDEVSSPMKKLAFRGSVLTDESFNELLKLLRYILELS
E
VEFDDCTLNGLGDFNPSESDVVSELGKVETVTIRRLHIPQFYLFYDLSTVYSLLEKVKRITVENSKVFL
V
PCSFSQHLKSLEFLDLSENLMVEEYLKNSACKGAWPSLQTLVLSQNHLRSMQKTGEILLTLKNLTSLDI
S
RNTFHPMPDSCQWPEKMRFLNLSSTGIRVVKTCIPQTLEVLDVSNNNLDSFSLFLPRLQELYISRNKLK
T
LPDASLFPVLLVMKIRENAVSTFSKDQLGSFPKLETLEAGDNHFVCSCELLSFTMETPALAQILVDWPD
S
YLCDSPPRLHGHRLQDARPSVLECHQAALVSGVCCALLLLILLVGALCHHFHGLWYLRMMWAWLQAKRK
P
KKAPCRDVCYDAFVSYSEQDSHWVENLMVQQLENSDPPFKLCLHKRDFVPGKWIIDNIIDSIEKSHKTV
F
VLSENFVRSEWCKYELDFSHFRLFDENNDAAILVLLEPIERKAIPQRFCKLRKIMNTKTYLEWPLDEGQ
Q
EVFWVNLRTAIKS




Links Key
 Links to:   History report
  BLAST report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser