NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS14869.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
14869.1 Public Mus musculus 1 Cfc1 21 106 86 CCDS HistoryNCBI Gene:12627Re-query CCDS DB by CCDS ID:14869.1Re-query CCDS DB by GeneID:12627See the combined annotation on chromosome 1 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 14869.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000027298 ENSMUSP00000027298 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000027298Link to Ensembl Protein Viewer:ENSMUSP00000027298Re-query CCDS DB by Nucleotide ID:ENSMUST00000027298Re-query CCDS DB by Protein ID:ENSMUSP00000027298
Original member Current member EBI,WTSI OTTMUST00000126125 OTTMUSP00000068257 Accepted alive Link to Vega Transcript Viewer:OTTMUST00000126125Link to Vega Protein Viewer:OTTMUSP00000068257Re-query CCDS DB by Nucleotide ID:OTTMUST00000126125Re-query CCDS DB by Protein ID:OTTMUSP00000068257
Original member Current member NCBI NM_007685.2 NP_031711.1 Accepted alive Link to Nucleotide Sequence:NM_007685.2Link to Protein Sequence:NP_031711.1Re-query CCDS DB by Nucleotide ID:NM_007685Re-query CCDS DB by Protein ID:NP_031711Link to BLink:NP_031711.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_031711.1 202 P97766 202 100% 0 0

Chromosomal Locations for CCDS 14869.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 1 (NC_000067.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 1Link to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1See the combined annotation on chromosome 1 in Sequence Viewer

Chromosome Start Stop Links
1 34535903 34535955 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 34536198 34536247 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 34536350 34536517 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 34537132 34537246 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 34537326 34537435 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1
1 34544025 34544137 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 1Link to Ensembl Genome Browser on chromosome 1Link to Vega Genome Browser on chromosome 1

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (609 nt):
ATGAGAGCGAACTCACCAACCCAGGGTATCAGTTTGAAAATGCATCAAGCCAGGCCTCTGTTTTTGGTGA
CT
GTCGCGCTGCAGCTCATCGGTCTGGGATACAGTTATCAGAGCGAAGGAGATGGTGCCAGAGAAGTCAG
C
AATATCCTCTCTCCAGTGATCCCCGGGACGACACTGGACAGAACTCTGAGTAATTCCAGCAGAAAGAAT
GAC
ATTCCGGAGGGGGCGCGCCTATGGGATTCCCTTCCTGACTCCAGCACTTTGGGAGAGAGTGCAGTCC
CT
GTATCCCGCTGTTGCCACAATGGCGGCACCTGTGTTCTGGGCAGTTTCTGCGTGTGCCCTGCCTATTT
C
ACTGGTCGCTATTGCGAGCACGACCAGAGGCGCAGAGACTGTGGTGCCCTAGGGCATGGAGCTTGGACC
CTG
CACAGCTGCCGCCTATGCAGGTGCATCTTCTCAGCCCTGTACTGCCTCCCACACCAAACGTTCAGCC
AC
TGTGACCTGAAAAGCTTCCTTTCTTCAGGCGCCAGAGGATCAAGAGAATGCAGCATCCCAAGCCTCCT
C
CTGCTGGTGCTCTGCCTCCTCCTGCAGGGTGTGGCTGGTAAGGGCTGA


Translation (202 aa):
MRANSPTQGISLKMHQARPLFLVTVALQLIGLGYSYQSEGDGAREVSNILSPVIPGTTLDRTLSNSSRKN
D
IPEGARLWDSLPDSSTLGE
SAVPVSRCCHNGGTCVLGSFCVCPAYFTGRYCEHDQRRRDCGALGHGAWT
L
HSCRLCRCIFSALYCLPHQTFSHC
DLKSFLSSGARGSRECSIPSLLLLVLCLLLQGVAGKG



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser