NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS26633.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
26633.1 Public Mus musculus 13 Tert 21 106 86 CCDS HistoryNCBI Gene:21752Re-query CCDS DB by CCDS ID:26633.1Re-query CCDS DB by GeneID:21752See the combined annotation on chromosome 13 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 26633.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000022104 ENSMUSP00000022104 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000022104Link to Ensembl Protein Viewer:ENSMUSP00000022104Re-query CCDS DB by Nucleotide ID:ENSMUST00000022104Re-query CCDS DB by Protein ID:ENSMUSP00000022104
Original member Current member NCBI NM_009354.1 NP_033380.1 Accepted alive Link to Nucleotide Sequence:NM_009354.1Link to Protein Sequence:NP_033380.1Re-query CCDS DB by Nucleotide ID:NM_009354Re-query CCDS DB by Protein ID:NP_033380Link to BLink:NP_033380.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_033380.1 1122 O70372 1122 100% 0 0

Chromosomal Locations for CCDS 26633.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 13 (NC_000079.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 13Link to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13See the combined annotation on chromosome 13 in Sequence Viewer

Chromosome Start Stop Links
13 73627030 73627248 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73627351 73628674 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73634152 73634347 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73635420 73635600 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73636357 73636536 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73637206 73637364 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73639156 73639257 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73639986 73640071 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73641976 73642089 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73642365 73642436 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73644249 73644437 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73646181 73646307 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73646777 73646838 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73647947 73648071 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73648288 73648416 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13
13 73648910 73649013 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 13Link to Ensembl Genome Browser on chromosome 13

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (3369 nt):
ATGACCCGCGCTCCTCGTTGCCCCGCGGTGCGCTCTCTGCTGCGCAGCCGATACCGGGAGGTGTGGCCGC
TG
GCAACCTTTGTGCGGCGCCTGGGGCCCGAGGGCAGGCGGCTTGTGCAACCCGGGGACCCGAAGATCTA
C
CGCACTTTGGTTGCCCAATGCCTAGTGTGCATGCACTGGGGCTCACAGCCTCCACCTGCCGACCTTTCC
TTC
CACCAGGTGTCATCCCTGAAAGAGCTGGTGGCCAGGGTTGTGCAGAGACTCTGCGAGCGCAACGAGA
GA
AACGTGCTGGCTTTTGGCTTTGAGCTGCTTAACGAGGCCAGAGGCGGGCCTCCCATGGCCTTCACTAG
T
AGCGTGCGTAGCTACTTGCCCAACACTGTTATTGAGACCCTGCGTGTCAGTGGTGCATGGATGCTACTG
TTG
AGCCGAGTGGGCGACGACCTGCTGGTCTACCTGCTGGCACACTGTGCTCTTTATCTTCTGGTGCCCC
CC
AGCTGTGCCTACCAGGTGTGTGGGTCTCCCCTGTACCAAATTTGTGCCACCACGGATATCTGGCCCTC
T
GTGTCCGCTAGTTACAGGCCCACCCGACCCGTGGGCAGGAATTTCACTAACCTTAGGTTCTTACAACAG
ATC
AAGAGCAGTAGTCGCCAGGAAGCACCGAAACCCCTGGCCTTGCCATCTCGAGGTACAAAGAGGCATC
TG
AGTCTCACCAGTACAAGTGTGCCTTCAGCTAAGAAGGCCAGATGCTATCCTGTCCCGAGAGTGGAGGA
G
GGACCCCACAGGCAGGTGCTACCAACCCCATCAGGCAAATCATGGGTGCCAAGTCCTGCTCGGTCCCCC
GAG
GTGCCTACTGCAGAGAAAGATTTGTCTTCTAAAGGAAAGGTGTCTGACCTGAGTCTCTCTGGGTCGG
TG
TGCTGTAAACACAAGCCCAGCTCCACATCTCTGCTGTCACCACCCCGCCAAAATGCCTTTCAGCTCAG
G
CCATTTATTGAGACCAGACATTTCCTTTACTCCAGGGGAGATGGCCAAGAGCGTCTAAACCCCTCATTC
CTA
CTCAGCAACCTCCAGCCTAACTTGACTGGGGCCAGGAGACTGGTGGAGATCATCTTTCTGGGCTCAA
GG
CCTAGGACATCAGGACCACTCTGCAGGACACACCGTCTATCGCGTCGATACTGGCAGATGCGGCCCCT
G
TTCCAACAGCTGCTGGTGAACCATGCAGAGTGCCAATATGTCAGACTCCTCAGGTCACATTGCAGGTTT
CGA
ACAGCAAACCAACAGGTGACAGATGCCTTGAACACCAGCCCACCGCACCTCATGGATTTGCTCCGCC
TG
CACAGCAGTCCCTGGCAGGTATATGGTTTTCTTCGGGCCTGTCTCTGCAAGGTGGTGTCTGCTAGTCT
C
TGGGGTACCAGGCACAATGAGCGCCGCTTCTTTAAGAACTTAAAGAAGTTCATCTCGTTGGGGAAATAC
GGC
AAGCTATCACTGCAGGAACTGATGTGGAAGATGAAAGTAGAGGATTGCCACTGGCTCCGCAGCAGCC
CG
GGGAAGGACCGTGTCCCCGCTGCAGAGCACCGTCTGAGGGAGAGGATCCTGGCTACGTTCCTGTTCTG
G
CTGATGGACACATACGTGGTACAGCTGCTTAGGTCATTCTTTTACATCACAGAGAGCACATTCCAGAAG
AAC
AGGCTCTTCTTCTACCGTAAGAGTGTGTGGAGCAAGCTGCAGAGCATTGGAGTCAGGCAACACCTTG
AG
AGAGTGCGGCTACGGGAGCTGTCACAAGAGGAGGTCAGGCATCACCAGGACACCTGGCTAGCCATGCC
C
ATCTGCAGACTGCGCTTCATCCCCAAGCCCAACGGCCTGCGGCCCATTGTGAACATGAGTTATAGCATG
GGT
ACCAGAGCTTTGGGCAGAAGGAAGCAGGCCCAGCATTTCACCCAGCGTCTCAAGACTCTCTTCAGCA
TG
CTCAACTATGAGCGGACAAAACATCCTCACCTTATGGGGTCTTCTGTACTGGGTATGAATGACATCTA
C
AGGACCTGGCGGGCCTTTGTGCTGCGTGTGCGTGCTCTGGACCAGACACCCAGGATGTACTTTGTTAAG
GCA
GATGTGACCGGGGCCTATGATGCCATCCCCCAGGGTAAGCTGGTGGAGGTTGTTGCCAATATGATCA
GG
CACTCGGAGAGCACGTACTGTATCCGCCAGTATGCAGTGGTCCGGAGAGATAGCCAAGGCCAAGTCCA
C
AAGTCCTTTAGGAGACAGGTCACCACCCTCTCTGACCTCCAGCCATACATGGGCCAGTTCCTTAAGCAT
CTG
CAGGATTCAGATGCCAGTGCACTGAGGAACTCCGTTGTCATCGAGCAGAGCATCTCTATGAATGAGA
GC
AGCAGCAGCCTGTTTGACTTCTTCCTGCACTTCCTGCGTCACAGTGTCGTAAAGATTGGTGACAGGTG
C
TATACGCAGTGCCAGGGCATCCCCCAGGGCTCCAGCCTATCCACCCTGCTCTGCAGTCTGTGTTTCGGA
GAC
ATGGAGAACAAGCTGTTTGCTGAGGTGCAGCGGGATGGGTTGCTTTTACGTTTTGTTGATGACTTTC
TG
TTGGTGACGCCTCACTTGGACCAAGCAAAAACCTTCCTCAGCACCCTGGTCCATGGCGTTCCTGAGTA
T
GGGTGCATGATAAACTTGCAGAAGACAGTGGTGAACTTCCCTGTGGAGCCTGGTACCCTGGGTGGTGCA
GCT
CCATACCAGCTGCCTGCTCACTGCCTGTTTCCCTGGTGTGGCTTGCTGCTGGACACTCAGACTTTGG
AG
GTGTTCTGTGACTACTCAGGTTATGCCCAGACCTCAATTAAGACGAGCCTCACCTTCCAGAGTGTCTT
C
AAAGCTGGGAAGACCATGCGGAACAAGCTCCTGTCGGTCTTGCGGTTGAAGTGTCACGGTCTATTTCTA
GAC
TTGCAGGTGAACAGCCTCCAGACAGTCTGCATCAATATATACAAGATCTTCCTGCTTCAGGCCTACA
G
G
TTCCATGCATGTGTGATTCAGCTTCCCTTTGACCAGCGTGTTAGGAAGAACCTCACATTCTTTCTGGG
C
ATCATCTCCAGCCAAGCATCCTGCTGCTATGCTATCCTGAAGGTCAAGAATCCAGGAATGACACTAAAG
GCC
TCTGGCTCCTTTCCTCCTGAAGCCGCACATTGGCTCTGCTACCAGGCCTTCCTGCTCAAGCTGGCTG
CT
CATTCTGTCATCTACAAATGTCTCCTGGGACCTCTGAGGACAGCCCAAAAACTGCTGTGCCGGAAGCT
C
CCAGAGGCGACAATGACCATCCTTAAAGCTGCAGCTGACCCAGCCCTAAGCACAGACTTTCAGACCATT
TTG
GACTAA


Translation (1122 aa):
MTRAPRCPAVRSLLRSRYREVWPLATFVRRLGPEGRRLVQPGDPKIYRTLVAQCLVCMHWGSQPPPADLS
F
HQ
VSSLKELVARVVQRLCERNERNVLAFGFELLNEARGGPPMAFTSSVRSYLPNTVIETLRVSGAWMLL
L
SRVGDDLLVYLLAHCALYLLVPPSCAYQVCGSPLYQICATTDIWPSVSASYRPTRPVGRNFTNLRFLQQ
I
KSSSRQEAPKPLALPSRGTKRHLSLTSTSVPSAKKARCYPVPRVEEGPHRQVLPTPSGKSWVPSPARSP
E
VPTAEKDLSSKGKVSDLSLSGSVCCKHKPSSTSLLSPPRQNAFQLRPFIETRHFLYSRGDGQERLNPSF
L
LSNLQPNLTGARRLVEIIFLGSRPRTSGPLCRTHRLSRRYWQMRPLFQQLLVNHAECQYVRLLRSHCRF
R
TANQQVTDALNTSPPHLMDLLRLHSSPWQVYGFLRACLCKVVSASLWGTRHNERRFFKNLKKFISLGKY
G
KLSLQELMWKMKVEDCHWLRSSP
GKDRVPAAEHRLRERILATFLFWLMDTYVVQLLRSFFYITESTFQK
N
RLFFYRKSVWSKLQSIGV
RQHLERVRLRELSQEEVRHHQDTWLAMPICRLRFIPKPNGLRPIVNMSYSM
G
TRALGRRKQ
AQHFTQRLKTLFSMLNYERTKHPHLMGSSVLGMNDIYRTWRAFVLRVRALDQTPRMYFVK
A
DVTGAYDAIPQGKLVEVVANMIRHSESTYCIRQYAVVRRDSQGQVHKSFRRQ
VTTLSDLQPYMGQFLKH
L
QDSDASALRNSVVIEQ
SISMNESSSSLFDFFLHFLRHSVVKIGDRCYTQCQGIPQGSSLSTLLCSLCFG
D
MENKLFAEVQRD
GLLLRFVDDFLLVTPHLDQAKTFLSTLVHGVPEYGCMINLQKTVVNFPVEPGTLGGA
A
PYQLPAHCLFPWCGLLLDTQTLEVFCDYS
GYAQTSIKTSLTFQSVFKAGKTMRNKLLSVLRLKCHGLFL
D
LQ
VNSLQTVCINIYKIFLLQAYRFHACVIQLPFDQRVRKNLTFFLGIISSQASCCYAILKVKNPGMTLK
A
SGSFPPEAAHWLCYQAFLLKLAAHSVIYKCLLGPLRT
AQKLLCRKLPEATMTILKAAADPALSTDFQTI
L
D




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser