NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene

Report for CCDS29538.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
29538.1 Public Mus musculus 19 Slc22a6 21 106 86 CCDS HistoryNCBI Gene:18399Re-query CCDS DB by CCDS ID:29538.1Re-query CCDS DB by GeneID:18399See the combined annotation on chromosome 19 in Sequence Viewer

Public since: CCDS release 2, NCBI annotation release 36.1, Ensembl annotation release 39

Review status: Provisional (this record has not been manually reviewed by the collaboration)

Sequence IDs included in CCDS 29538.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENSMUST00000010250 ENSMUSP00000010250 Accepted alive Link to Ensembl Transcript Viewer:ENSMUST00000010250Link to Ensembl Protein Viewer:ENSMUSP00000010250Re-query CCDS DB by Nucleotide ID:ENSMUST00000010250Re-query CCDS DB by Protein ID:ENSMUSP00000010250
Original member Current member NCBI NM_008766.3 NP_032792.2 Accepted alive Link to Nucleotide Sequence:NM_008766.3Link to Protein Sequence:NP_032792.2Re-query CCDS DB by Nucleotide ID:NM_008766Re-query CCDS DB by Protein ID:NP_032792Link to BLink:NP_032792.2

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_032792.2 545 Q8VC69 545 100% 0 0

Chromosomal Locations for CCDS 29538.1

Assembly GRCm38.p4 (GCF_000001635.24)

On '+' strand of Chromosome 19 (NC_000085.6)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 19Link to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19See the combined annotation on chromosome 19 in Sequence Viewer

Chromosome Start Stop Links
19 8618296 8618646 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8619003 8619106 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8619315 8619469 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8621191 8621359 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8621786 8621909 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8622042 8622157 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8623464 8623678 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8623820 8623928 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8625633 8625836 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19
19 8626121 8626211 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 19Link to Ensembl Genome Browser on chromosome 19

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (1638 nt):
ATGGCCTTCAATGACCTCCTGAAACAGGTGGGGGGTGTCGGACGCTTCCAGCTGATCCAGGTCACCATGG
TG
GTTGCTCCCCTACTGCTGATGGCTTCCCACAACACCCTGCAGAACTTCACTGCTGCTATCCCCGCTCA
C
CACTGCCGCCCACCTGCTAATGCCAACCTCAGCAAAGATGGAGGTCTGGAGGCCTGGCTGCCCCTGGAC
AAG
CAAGGACGACCCGAATCTTGCCTCCGCTTTCCTTTCCCGCACAATGGCACAGAGGCCAATGGCACCG
GA
GTCACAGAGCCCTGCCTTGATGGCTGGGTCTATGACAACAGCACCTTCCCTTCAACCATCGTGACTGA
G
TGGAACCTTGTGTGCTCTCATCGGGCCTTCCGCCAGCTGGCCCAGTCCCTGTTCATGGTGGGAGTGTTA
CTG
GGAGCCATGATGTTTGGCTACCTGGCGGACAGGCTGGGCCGTCGGAAGGTGCTGATCTTGAACTACC
TG
CAAACAGCTGTGTCGGGAACCTGTGCAGCCTATGCACCCAACTATACTGTCTACTGCATTTTCCGGCT
C
CTCTCGGGCATGTCTTTGGCTAGCATTGCAATCAACTGCATGACACTAAACATGGAGTGGATGCCTATT
CAC
ACCCGTGCCTATGTGGGCACCTTGATTGGCTATGTCTACAGCTTGGGCCAGTTCCTCCTGGCTGGTA
TC
GCCTATGCTGTGCCCCACTGGCGCCACCTGCAGCTTGCGGTCTCTGTGCCTTTTTTCGTTGCCTTCAT
C
TACTCTTGGTTCTTCATTGAGTCAGCCCGCTGGTACTCCTCCTCTGGAAGGCTGGACCTCACCCTCCGA
GCC
CTGCAGAGAGTGGCCCGCATCAACGGGAAACAAGAAGAGGGGGCTAAGCTGAGTATAGAGGTGCTCC
AG
ACCAGCCTGCAGAAGGAACTGACTCTAAACAAAGGCCAGGCCTCCGCCATGGAGCTGCTGCGCTGCCC
C
ACGCTTCGGCGCCTCTTCCTCTGCCTCTCTATGCTGTGGTTTGCCACTAGCTTTGCCTACTACGGGCTG
GTC
ATGGACCTGCAGGGCTTTGGGGTCAGCATGTACCTTATCCAGGTGATTTTCGGCGCTGTGGACCTGC
CT
GCCAAGTTTGTGTGCTTCCTAGTCATCAATTCCATGGGCCGCCGGCCTGCACAGTTGGCCTCCCTGCT
G
CTGGCAGGCATCTGTATCCTAGTGAATGGCATAATACCGAGGGGCCATACAATCATTCGCACATCCCTG
GCT
GTACTAGGGAAAGGCTGTCTGGCTTCCTCTTTCAACTGCATCTTCCTGTACACCGGAGAGCTGTACC
CC
ACAATGATTCGGCAGACGGGCCTGGGCATGGGCAGCACCATGGCCCGGGTGGGCAGCATAGTGAGCCC
A
CTGATAAGCATGACTGCCGAGTTCTACCCCTCCATACCTCTCTTCATCTTCGGCGCTGTCCCCGTGGCC
GCC
AGCGCTGTCACTGCCCTGCTGCCAGAGACCTTGGGCCAGCCGCTGCCTGATACAGTGCAGGACCTGA
AG
AGCAGGAGCAGAGGAAAGCAGAAGCAACAGCAGCTGGAACAGCAGAAGCAGATGATACCACTCCAGGT
C
TCAACACAAGAGAAGAACGGACTCTGA


Translation (545 aa):
MAFNDLLKQVGGVGRFQLIQVTMVVAPLLLMASHNTLQNFTAAIPAHHCRPPANANLSKDGGLEAWLPLD
K
QGRPESCLRFPFPHNGTEANGTGVTEPCLDGWVYDNSTFPSTIVTE
WNLVCSHRAFRQLAQSLFMVGVL
L
GAMMFGYLAD
RLGRRKVLILNYLQTAVSGTCAAYAPNYTVYCIFRLLSGMSLASIAINCMTLNMEWMPI
H
TRAYVGTLIGYVYSLGQFLLAGIAYAVPHWRHLQLAVSVPFFVAFIYS
WFFIESARWYSSSGRLDLTLR
A
LQRVARINGKQEEGAKLSIE
VLQTSLQKELTLNKGQASAMELLRCPTLRRLFLCLSMLWFATSFAYYGL
V
MDLQGFGVSMYLIQVIFGAVDLPAKFVCFLVINSMGRRPAQLASLLLAGICILVNGIIPR
GHTIIRTSL
A
VLGKGCLASSFNCIFLYTGELYPTMI
RQTGLGMGSTMARVGSIVSPLISMTAEFYPSIPLFIFGAVPVA
A
SAVTALLPETLGQPLPDTVQDLKS
RSRGKQKQQQLEQQKQMIPLQVSTQEKNGL



Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser