NCBI CCDS banner
PubMed Entrez Gene BLAST OMIM
  

CCDS
Home
FTP
Process
Releases & Statistics
Curation Guidelines

Collaborators
EBI
HGNC
MGI
NCBI
UCSC
WTSI

Contact Us
email CCDS

Genome Displays

Ensembl
Genome Browser
Map Viewer
VEGA

Related Resources
Gene
HomoloGene
RefSeq
UniGene


Report for CCDS4937.1 (current version)

CCDS Status Species Chrom. Gene CCDS Release NCBI Annotation Release Ensembl Annotation Release Links
4937.1 Public Homo sapiens 6 IL17A 20 108 85 CCDS HistoryNCBI Gene:3605Re-query CCDS DB by CCDS ID:4937.1Re-query CCDS DB by GeneID:3605See the combined annotation on chromosome 6 in Sequence Viewer

Public since: CCDS release 1, NCBI annotation release 35.1, Ensembl annotation release 23

Review status: Reviewed (by RefSeq and Havana)

Sequence IDs included in CCDS 4937.1

Original Current Source Nucleotide ID Protein ID Status in CCDS Seq. Status Links
Original member Current member EBI,WTSI ENST00000340057 ENSP00000344192 Accepted alive Link to Ensembl Transcript Viewer:ENST00000340057Link to Ensembl Protein Viewer:ENSP00000344192Re-query CCDS DB by Nucleotide ID:ENST00000340057Re-query CCDS DB by Protein ID:ENSP00000344192
Original member Current member EBI,WTSI OTTHUMT00000040892 OTTHUMP00000016597 Accepted alive Link to Vega Transcript Viewer:OTTHUMT00000040892Link to Vega Protein Viewer:OTTHUMP00000016597Re-query CCDS DB by Nucleotide ID:OTTHUMT00000040892Re-query CCDS DB by Protein ID:OTTHUMP00000016597
Original member Current member NCBI NM_002190.2 NP_002181.1 Accepted alive Link to Nucleotide Sequence:NM_002190.2Link to Protein Sequence:NP_002181.1Re-query CCDS DB by Nucleotide ID:NM_002190Re-query CCDS DB by Protein ID:NP_002181Link to BLink:NP_002181.1

RefSeq Length Related UniProtKB/SwissProt Length Identity Gaps Mismatches
NP_002181.1 155 Q16552 155 100% 0 0

Chromosomal Locations for CCDS 4937.1

Assembly GRCh38.p7 (GCF_000001405.33)

On '+' strand of Chromosome 6 (NC_000006.12)
Genome Browser links: Link to NCBI NucleotideLink to NCBI Map Viewer on chromosome 6Link to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6See the combined annotation on chromosome 6 in Sequence Viewer

Chromosome Start Stop Links
6 52186432 52186458 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 52187603 52187805 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6
6 52189055 52189292 Link to NCBI NucleotideLink to NCBI Map ViewerLink to UCSC Genome Browser on chromosome 6Link to Ensembl Genome Browser on chromosome 6Link to Vega Genome Browser on chromosome 6

CCDS Sequence Data
Blue highlighting indicates alternating exons.
Red highlighting indicates amino acids encoded across a splice junction.
 
Mouse over the nucleotide or protein sequence below and click on the highlighted codon or residue to select the pair.

Nucleotide Sequence (468 nt):
ATGACTCCTGGGAAGACCTCATTGGTGTCACTGCTACTGCTGCTGAGCCTGGAGGCCATAGTGAAGGCAG
GA
ATCACAATCCCACGAAATCCAGGATGCCCAAATTCTGAGGACAAGAACTTCCCCCGGACTGTGATGGT
C
AACCTGAACATCCATAACCGGAATACCAATACCAATCCCAAAAGGTCCTCAGATTACTACAACCGATCC
ACC
TCACCTTGGAATCTCCACCGCAATGAGGACCCTGAGAGATATCCCTCTGTGATCTGGGAGGCAAAGT
GC
CGCCACTTGGGCTGCATCAACGCTGATGGGAACGTGGACTACCACATGAACTCTGTCCCCATCCAGCA
A
GAGATCCTGGTCCTGCGCAGGGAGCCTCCACACTGCCCCAACTCCTTCCGGCTGGAGAAGATACTGGTG
TCC
GTGGGCTGCACCTGTGTCACCCCGATTGTCCACCATGTGGCCTAA


Translation (155 aa):
MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRS
T
SPWNL
HRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILV
S
VGCTCVTPIVHHVA




Links Key
 Links to:   History report
  BLink report
  Entrez Gene
  Nucleotide report
  Protein report
 Re-query CCDS DB by:   CCDS ID
  Gene ID
  Nucleotide ID
  Protein ID
 Genome Browser Links:   Ensembl Genome Browser
  NCBI Map Viewer
  NCBI Sequence Viewer
  UCSC Genome Browser
  VEGA Genome Browser